Potri.016G057400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57270 416 / 3e-146 BG1 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
AT3G57240 413 / 4e-145 BG3 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
AT3G57260 386 / 2e-134 AtPR2, PR-2, PR2, BG2, BGL2 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1)
AT4G16260 344 / 9e-118 Glycosyl hydrolase superfamily protein (.1)
AT5G56590 244 / 1e-76 O-Glycosyl hydrolases family 17 protein (.1)
AT1G77780 223 / 3e-70 Glycosyl hydrolase superfamily protein (.1)
AT5G20390 219 / 4e-69 Glycosyl hydrolase superfamily protein (.1)
AT1G77790 216 / 2e-67 Glycosyl hydrolase superfamily protein (.1)
AT5G20340 216 / 2e-67 BG5 beta-1,3-glucanase 5 (.1)
AT2G01630 215 / 6e-67 O-Glycosyl hydrolases family 17 protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G057600 587 / 0 AT3G57270 414 / 2e-145 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.006G048100 573 / 0 AT3G57270 382 / 6e-133 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.006G046100 424 / 2e-149 AT3G57270 370 / 4e-128 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.010G142800 379 / 5e-131 AT4G16260 433 / 2e-152 Glycosyl hydrolase superfamily protein (.1)
Potri.010G143166 364 / 5e-126 AT4G16260 432 / 5e-153 Glycosyl hydrolase superfamily protein (.1)
Potri.001G255100 355 / 3e-122 AT4G16260 369 / 9e-128 Glycosyl hydrolase superfamily protein (.1)
Potri.009G050300 300 / 5e-101 AT4G16260 285 / 5e-95 Glycosyl hydrolase superfamily protein (.1)
Potri.005G172000 265 / 2e-86 AT1G77780 338 / 6e-115 Glycosyl hydrolase superfamily protein (.1)
Potri.009G050401 258 / 3e-85 AT4G16260 263 / 2e-87 Glycosyl hydrolase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019801 428 / 6e-151 AT3G57270 367 / 6e-127 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10014109 421 / 4e-148 AT3G57270 361 / 1e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10014108 413 / 8e-142 AT3G57270 366 / 3e-123 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10002807 381 / 3e-132 AT3G57240 339 / 7e-116 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
Lus10014110 369 / 3e-128 AT3G57270 359 / 2e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10027860 368 / 3e-127 AT3G57260 322 / 4e-109 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1)
Lus10031037 319 / 6e-108 AT3G57240 312 / 3e-105 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
Lus10016883 304 / 3e-102 AT4G16260 391 / 1e-136 Glycosyl hydrolase superfamily protein (.1)
Lus10010091 271 / 4e-85 AT1G02305 520 / 0.0 Cysteine proteinases superfamily protein (.1)
Lus10035423 248 / 5e-80 AT3G57270 266 / 3e-87 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence
>Potri.016G057400.1 pacid=42810309 polypeptide=Potri.016G057400.1.p locus=Potri.016G057400 ID=Potri.016G057400.1.v4.1 annot-version=v4.1
ATGGCTAGATCAAATTTAGCTGGCAAAGGCCCTTCCATGATTTCCATAATGCTACTCTTTGGGCTCCTACTAGCTAGCCTAGATACAACAGGTGCCCAGA
TAGGTGTTTGCTATGGAATGCTTGGTAACTTACCACCACCATCAGAAGTCATAGCTCTCTACAACCAGAGGGGCATTCGCAGAATGCGACTTTATGATCC
AAACCAAGATGCTCTACGAGCCCTTGGAGGCACCAACATTGAGCTCATGCTAGGTCTTCCAAATCCGGATCTTCAAAGGATTGCTTCCAGTCAAGCCAAC
GCAAATGCATGGGTGCAAAGCAATGTAAAAATTTTTGGCAATGTCAAGTTTCGATACATTGCGGTAGGAAATGAGGTTAAGCCCTCAGATTCATTCGCAC
AGTTTCTAGTCCCTGCCATGCAAAACATTCGCAACGCACTCAATTCAGCTGGACTAGGAAGTATCAAAGTTTCAACCGCTATTGATAATGGGGTCATAGC
AGATGGTTCCTTCCCTCCCTCAAAAAGCTCTTTCAAGGGAGACTATAGACCACTTCTCGATCCGATCATTCGCTTTTTAGTGAACAACCAAGCTCCATTA
CTGCTTAACTCGTATCCATACATCAGTTACTCACTTAACACAAGAGACATTCGTCTTGATTATGCTCTTTTCACAGCTCCATCACCACTAGTCTCTGACC
CACCACTGAATTACCAAAACCTCTTCGATGCCCTTCTTGACACTGTTTACGCTGCTTTGGAGAAATCTGGAGGGGGTTCTTTGGAAATCGTGGTATCAGA
GAGTGGTTGGCCAACGGCTGGAGGGACAGGAACATCGGTTGATAATGCAAGAACTTATAACAACAACTTAGTTCAACATGTGAAGAAAGGAACCCCAAAG
AGGCCTGGAAAGCCTATAGAAACTTATATTTTTGCCATGTTTGATGAGAGTAACAAAAACCCTGAACTTGAGAAACATTGGGGGCTCTTTTCTCCAAATA
AACAGCCAAAATATGACATCAATCTCAACTAA
AA sequence
>Potri.016G057400.1 pacid=42810309 polypeptide=Potri.016G057400.1.p locus=Potri.016G057400 ID=Potri.016G057400.1.v4.1 annot-version=v4.1
MARSNLAGKGPSMISIMLLFGLLLASLDTTGAQIGVCYGMLGNLPPPSEVIALYNQRGIRRMRLYDPNQDALRALGGTNIELMLGLPNPDLQRIASSQAN
ANAWVQSNVKIFGNVKFRYIAVGNEVKPSDSFAQFLVPAMQNIRNALNSAGLGSIKVSTAIDNGVIADGSFPPSKSSFKGDYRPLLDPIIRFLVNNQAPL
LLNSYPYISYSLNTRDIRLDYALFTAPSPLVSDPPLNYQNLFDALLDTVYAALEKSGGGSLEIVVSESGWPTAGGTGTSVDNARTYNNNLVQHVKKGTPK
RPGKPIETYIFAMFDESNKNPELEKHWGLFSPNKQPKYDINLN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Potri.016G057400 0 1
AT4G30460 glycine-rich protein (.1) Potri.006G178200 1.41 0.9936
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Potri.006G179300 2.44 0.9919
AT5G10770 Eukaryotic aspartyl protease f... Potri.018G014900 3.87 0.9769
Potri.008G028050 4.47 0.9564
AT5G10770 Eukaryotic aspartyl protease f... Potri.018G014700 4.89 0.9668
AT3G28960 Transmembrane amino acid trans... Potri.008G086500 5.29 0.9696
AT3G56630 CYP94D2 "cytochrome P450, family 94, s... Potri.016G031850 6.00 0.9600
AT5G24090 ATCHIA chitinase A (.1) Potri.002G165700 6.00 0.9762 CHI3.11
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Potri.016G057600 6.32 0.8846
AT1G43650 nodulin MtN21 /EamA-like trans... Potri.002G068300 6.48 0.9244

Potri.016G057400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.