Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06690 212 / 3e-70 WCRKC1 WCRKC thioredoxin 1 (.1.2) AT5G04260 152 / 7e-47 WCRKC2 WCRKC thioredoxin 2 (.1) AT3G15360 60 / 3e-11 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT4G03520 59 / 8e-11 ATHM2 Thioredoxin superfamily protein (.1.2) AT1G03680 57 / 3e-10 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT1G45145 56 / 3e-10 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT1G19730 55 / 5e-10 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT5G42980 53 / 3e-09 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G52990 54 / 1e-08 thioredoxin family protein (.1) AT5G39950 50 / 4e-08 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G225701 [exp] 159 / 1e-49 AT5G04260 204 / 3e-67 WCRKC thioredoxin 2 (.1) Potri.008G036400 [exp] 155 / 6e-48 AT5G04260 216 / 8e-72 WCRKC thioredoxin 2 (.1) Potri.013G132200 [exp] 59 / 6e-11 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 58 / 1e-10 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 57 / 2e-10 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.002G073000 [exp] 57 / 3e-10 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.005G186800 [exp] 57 / 4e-10 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.017G076700 [exp] 56 / 4e-10 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.004G031700 [exp] 53 / 3e-09 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021067 [exp] 214 / 5e-71 AT5G06690 215 / 3e-71 WCRKC thioredoxin 1 (.1.2) Lus10017244 [exp] 152 / 3e-47 AT5G06690 156 / 2e-48 WCRKC thioredoxin 1 (.1.2) Lus10038703 [exp] 139 / 5e-41 AT5G04260 191 / 2e-61 WCRKC thioredoxin 2 (.1) Lus10037975 [exp] 127 / 3e-38 AT5G04260 149 / 3e-47 WCRKC thioredoxin 2 (.1) Lus10029752 [exp] 59 / 8e-11 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 58 / 1e-10 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 58 / 2e-10 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014798 [exp] 54 / 3e-09 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10005258 [exp] 53 / 5e-09 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10040887 [exp] 53 / 8e-09 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.016G059500.6 pacid=42809006 polypeptide=Potri.016G059500.6.p locus=Potri.016G059500 ID=Potri.016G059500.6.v4.1 annot-version=v4.1 ATGTCAGTTTTAGCAGCGAATCCTCACGTTTTATACAGAGAAGTGCAGTACCACAATAAAGACCAACAGCAACAGTTATGGAGTGGTGGTGGTGTTGGTA GCAGTTTATTGTTATCGCAAAGAACTTCTTTTGGGTGTTCTTGGTTTGATGGCAGAAACAAAGACTTGTGTAAAAAGAATTCAAAGAGAGATCTTAAAGT AGCAGCGTCTTGGCCAGGTATGACTAGGCCAACCTCCGTAGAGATGGAACCCATCGATGATTCTCACCATCTTGATAAGATTCTTCTTCAGGCTCACGAG CTTTCCCAGCCCATTATCATTGACTGGATGGCTTCTTGGTGCCGGAAATGCATTTATTTGAAGCCAAAGTTGGAGAAATTGGCTGCGGAATATGATACCA AAATCAAATTTTATTGCGTGGATGTCAACAAGGTGCCTCAGGCTTTAGTGAAGCGTGGAAATATATCTAAAATGCCTACCATTCAGTTATGGAAAGAGGG AGAGATGAAAGCAGAGGTGATCGGAGGGCACAAGGCTTGGCTTGTGATGGAAGAAGTGAGAGAAATGATCCAGAAATTCGTATGA
AA sequence Show only first row Show all	>Potri.016G059500.6 pacid=42809006 polypeptide=Potri.016G059500.6.p locus=Potri.016G059500 ID=Potri.016G059500.6.v4.1 annot-version=v4.1 MSVLAANPHVLYREVQYHNKDQQQQLWSGGGVGSSLLLSQRTSFGCSWFDGRNKDLCKKNSKRDLKVAASWPGMTRPTSVEMEPIDDSHHLDKILLQAHE LSQPIIIDWMASWCRKCIYLKPKLEKLAAEYDTKIKFYCVDVNKVPQALVKRGNISKMPTIQLWKEGEMKAEVIGGHKAWLVMEEVREMIQKFV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G06690		WCRKC1	WCRKC thioredoxin 1 (.1.2)		Potri.016G059500 [exp]	0	1
AT3G26070			Plastid-lipid associated prote...		Potri.001G209600 [exp]	7.34	0.9638
AT2G37220			RNA-binding (RRM/RBD/RNP motif...		Potri.006G127200 [exp]	7.87	0.9516	RBP29.2
AT3G48000		ALDH2A, ALDH2B4	aldehyde dehydrogenase 2A, ald...		Potri.015G074100 [exp]	11.66	0.9403	Pt-ALDH1.3
AT5G66190		ATLFNR1	ferredoxin-NADP\(+\)-oxidoredu...		Potri.007G057200 [exp]	17.88	0.9446
AT2G33450			Ribosomal L28 family (.1)		Potri.010G068500 [exp]	19.05	0.9460
AT3G61320			Bestrophin-like protein (.1)		Potri.014G082900 [exp]	24.18	0.9399
AT2G29180			unknown protein		Potri.001G243500 [exp]	25.37	0.9409
AT5G43750		PnsB5, NDH18	Photosynthetic NDH subcomplex...		Potri.010G078800 [exp]	27.92	0.9435
AT2G18940			Tetratricopeptide repeat (TPR)...		Potri.006G166200 [exp]	29.32	0.9378
AT4G32260		PDE334	PIGMENT DEFECTIVE 334, ATPase,...		Potri.006G255600 [exp]	32.44	0.9335

Compare expression of checked genes

Potri.016G059500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.