Plant FIBer expression Database

Potri.016G060550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12012 93 / 4e-27 CPuORF20 conserved peptide upstream open reading frame 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017227
[exp]
107 / 5e-29 AT3G12010 812 / 0.0 unknown protein
Lus10021085
[exp]
105 / 2e-28 AT3G12010 722 / 0.0 unknown protein
PFAM info
Representative CDS sequence
>Potri.016G060550.1 pacid=42808896 polypeptide=Potri.016G060550.1.p locus=Potri.016G060550 ID=Potri.016G060550.1.v4.1 annot-version=v4.1
ATGAAAGAAAGGAATACTACTTCTACGCTGAGACGAGTCTTAGTTAATTGTGCTGCCCAGGCAAAAGAATACGGGGGATGTGTTGCGGCAAAGGTTCCAG
AAATTGAGCGTGATATGTGTTTGAAAGAATTTCTTGCTCTAAAGAATTGCATGCAGAATACAATTAGAGGAAAGGCTTGA
AA sequence
>Potri.016G060550.1 pacid=42808896 polypeptide=Potri.016G060550.1.p locus=Potri.016G060550 ID=Potri.016G060550.1.v4.1 annot-version=v4.1
MKERNTTSTLRRVLVNCAAQAKEYGGCVAAKVPEIERDMCLKEFLALKNCMQNTIRGKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G12012 CPuORF20 conserved peptide upstream ope... Potri.016G060550
[exp]
0 1
AT5G54680 bHLH bHLH105, ILR3 iaa-leucine resistant3, basic ... Potri.001G416600
[exp]
10.19 0.7141
AT4G02340 alpha/beta-Hydrolases superfam... Potri.013G134900
[exp]
19.74 0.7070
Potri.012G127000
[exp]
27.71 0.6733
AT1G70570 anthranilate phosphoribosyltra... Potri.010G044900
[exp]
33.54 0.6962
AT4G05420 DDB1A damaged DNA binding protein 1A... Potri.001G357900
[exp]
48.16 0.6026 Pt-DDB1.1
AT5G36930 Disease resistance protein (TI... Potri.012G135700
[exp]
58.78 0.6782
AT5G11380 DXPS3 1-deoxy-D-xylulose 5-phosphate... Potri.018G031800
[exp]
60.90 0.6736
AT5G15080 Protein kinase superfamily pro... Potri.008G194700
[exp]
61.31 0.6663
AT4G26540 Leucine-rich repeat receptor-l... Potri.001G467300
[exp]
75.93 0.6518
AT3G01130 unknown protein Potri.009G125832
[exp]
85.69 0.6287

Potri.016G060550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.