Potri.016G061100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G57860 305 / 7e-108 Translation protein SH3-like family protein (.1)
AT1G57660 305 / 7e-108 Translation protein SH3-like family protein (.1)
AT1G09690 304 / 7e-108 Translation protein SH3-like family protein (.1)
AT1G09590 304 / 7e-108 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195400 329 / 1e-117 AT1G57860 305 / 5e-108 Translation protein SH3-like family protein (.1)
Potri.003G159500 310 / 6e-110 AT1G09690 305 / 4e-108 Translation protein SH3-like family protein (.1)
Potri.001G071100 304 / 9e-108 AT1G09690 307 / 7e-109 Translation protein SH3-like family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016241 304 / 1e-107 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10030882 302 / 6e-107 AT1G09690 296 / 2e-104 Translation protein SH3-like family protein (.1)
Lus10029302 302 / 9e-107 AT1G09690 294 / 1e-103 Translation protein SH3-like family protein (.1)
Lus10030607 301 / 1e-106 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10021079 287 / 8e-101 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Lus10017232 287 / 8e-101 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01157 Ribosomal_L21e Ribosomal protein L21e
Representative CDS sequence
>Potri.016G061100.1 pacid=42809826 polypeptide=Potri.016G061100.1.p locus=Potri.016G061100 ID=Potri.016G061100.1.v4.1 annot-version=v4.1
ATGCCGGCTGGTCACGGTCTCCGGTCTCGCACTAGAGATCTCTTCGCTCGTCCCTTTAGAAAGAAGGGTTACATTCCATTGACAACCTACCTCAGAACCT
ATAAGATTGGAGACCATGTAGACGTTAAGGTTAACGGCGCCGTCCACAAGGGTATGCCTCACAAGTTTTACCATGGACGTACTGGCAGAGTCTGGAATGT
CACCAAACGTGCCATCGGCGTAGAGGTCAACAAGCAGGTGGGTAACAGGATCATCAGGAAGAGGATCCATGTCAGAGTGGAACATTTGCTACCCTCAAGG
TGCACTGAGGAATTCCGTCTCAGGAAGAAGAAGAATGATCAACTAAAGGCAGAGGCTAAGGCCAGAGGTGAGGTTATCTGCACAAAGAGGCAGCCAGAGG
GTCCTAAACCTGGTTTCATGGTGGAAGGTGCTACATTGGAAACTGTTACTCCCATTCCATATGATGTTGTTAACGATCTCAAGGGAGGTTATTAG
AA sequence
>Potri.016G061100.1 pacid=42809826 polypeptide=Potri.016G061100.1.p locus=Potri.016G061100 ID=Potri.016G061100.1.v4.1 annot-version=v4.1
MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKIGDHVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEVNKQVGNRIIRKRIHVRVEHLLPSR
CTEEFRLRKKKNDQLKAEAKARGEVICTKRQPEGPKPGFMVEGATLETVTPIPYDVVNDLKGGY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G57860 Translation protein SH3-like f... Potri.016G061100 0 1
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G454000 1.41 0.9727
AT3G11940 AML1, ATRPS5A ARABIDOPSIS MINUTE-LIKE 1, rib... Potri.006G197700 4.00 0.9609 RPS5.2
AT4G09800 RPS18C S18 ribosomal protein (.1) Potri.002G051300 5.47 0.9558
AT5G09510 Ribosomal protein S19 family p... Potri.010G076900 6.16 0.9338 RPS15.2
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Potri.002G056200 6.32 0.9510 Pt-RPS12.2
AT1G57720 Translation elongation factor ... Potri.019G077000 6.63 0.9424
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Potri.016G063200 7.00 0.9530 Pt-RPS5.1
AT5G35530 Ribosomal protein S3 family pr... Potri.006G222100 7.14 0.9598
AT3G44750 HDT1, HDA3, ATH... HISTONE DEACETYLASE 2A, histon... Potri.004G188800 8.48 0.9146 HDT902,Pt-HD2.1
AT5G02610 Ribosomal L29 family protein ... Potri.008G048800 10.67 0.9541 RPL35.1

Potri.016G061100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.