Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61172 54 / 3e-11 LCR8 low-molecular-weight cysteine-rich 8 (.1) AT5G47077 50 / 5e-10 LCR6 low-molecular-weight cysteine-rich 6 (.1) AT3G61175 44 / 2e-07 LCR52 low-molecular-weight cysteine-rich 52 (.1) AT3G61177 43 / 6e-07 LCR53 low-molecular-weight cysteine-rich 53 (.1) AT3G20997 40 / 6e-06 LCR55 low-molecular-weight cysteine-rich 55 (.1) AT4G29290 40 / 9e-06 LCR26 low-molecular-weight cysteine-rich 26 (.1) AT5G47075 39 / 1e-05 LCR20 low-molecular-weight cysteine-rich 20 (.1) AT4G29280 39 / 2e-05 LCR22 low-molecular-weight cysteine-rich 22 (.1) AT4G29305 37 / 0.0001 LCR25 low-molecular-weight cysteine-rich 25 (.1) AT2G10535 35 / 0.0004 LCR29 low-molecular-weight cysteine-rich 29 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G044800 [exp] 42 / 2e-06 AT4G29280 40 / 1e-05 low-molecular-weight cysteine-rich 22 (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [poplar] [flax] Knottin_1 PF07333 [poplar] [flax] SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence Show only first row Show all	>Potri.016G061600.1 pacid=42810635 polypeptide=Potri.016G061600.1.p locus=Potri.016G061600 ID=Potri.016G061600.1.v4.1 annot-version=v4.1 ATGGCTAGCTTCACCAGTCTTTTCTGTGCTGTTTTCCTAGTTTTCTCAGCCTTGATGGTGCATCATGCCGCTGCACAAGAAATGTGCCACAATCTAATTC CTGGAAATGGGAATTGTGATGCCTCAACATGCCAGATGCAGTGCTCCAGCTTAAACCAGGGAACAGGAGCATGCACTCAAACTTTTACAAATCGATTCAA TTGCATTTGCAACTGGGAATGTTCTTAG
AA sequence Show only first row Show all	>Potri.016G061600.1 pacid=42810635 polypeptide=Potri.016G061600.1.p locus=Potri.016G061600 ID=Potri.016G061600.1.v4.1 annot-version=v4.1 MASFTSLFCAVFLVFSALMVHHAAAQEMCHNLIPGNGNCDASTCQMQCSSLNQGTGACTQTFTNRFNCICNWECS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61172		LCR8	low-molecular-weight cysteine-...		Potri.016G061600 [exp]	0	1
AT3G50120			Plant protein of unknown funct...		Potri.001G071400 [exp]	5.19	0.9673
AT5G22870			Late embryogenesis abundant (L...		Potri.009G003800 [exp]	6.63	0.9652
AT3G20600		NDR1	non race-specific disease resi...		Potri.004G023400 [exp]	9.79	0.9533
					Potri.001G444350 [exp]	10.00	0.9414
AT1G54860			Glycoprotein membrane precurso...		Potri.005G034300 [exp]	10.53	0.9563
AT1G53540			HSP20-like chaperones superfam...		Potri.006G093400 [exp]	10.81	0.8704
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Potri.010G104900 [exp]	11.35	0.9213	RDR903
AT5G15100		ATPIN8, PIN8	PIN-FORMED 8, Auxin efflux car...		Potri.017G078300 [exp]	12.08	0.8992	PIN14
AT5G18970			AWPM-19-like family protein (....		Potri.008G200300 [exp]	12.32	0.9560
AT2G39710			Eukaryotic aspartyl protease f...		Potri.010G201400 [exp]	14.45	0.8253

Compare expression of checked genes

Potri.016G061600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.