Plant FIBer expression Database

Potri.016G062800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03220 249 / 5e-86 Mediator complex, subunit Med7 (.1)
AT5G03500 245 / 2e-84 Mediator complex, subunit Med7 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029326
[exp]
278 / 3e-97 AT5G03500 267 / 7e-93 Mediator complex, subunit Med7 (.1.2.3)
Lus10016217
[exp]
276 / 2e-96 AT5G03500 269 / 7e-94 Mediator complex, subunit Med7 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05983 Med7 MED7 protein
Representative CDS sequence
>Potri.016G062800.1 pacid=42809465 polypeptide=Potri.016G062800.1.p locus=Potri.016G062800 ID=Potri.016G062800.1.v4.1 annot-version=v4.1
ATGGCAACAGCTACATTTCCACCACCGCCACCGTTTTACAGACTGTACAAAGATTATATTGAAAACCCTAAATCAGCTCCAGAACCTCCTCCTCCTATTG
AAGGCACTTATGTGTGTTTTGCTAGCAGTTACACTACTGATGATGTGCTTCCAAGCTTAGAAGAGCAGGGAGTGCGACAACTGTACCCAAAAGGACCAAA
TGTTGATTTCAAGAAAGAACTGAGGTCACTTAATAGAGAATTGCAGCTTCACATTTTGGAGCTTGCCGATGTTCTTGTTGAGAGACCTTCACAATATGCT
AGGAGAGTGGAAGACATTTCCCTTATCTTCAAGAATTTGCATCACCTTCTCAATTCTTTGCGTCCCCATCAGGCTAGGGCCACATTGATACATATTCTAG
AGCTTCAGATACAACGTCGTAAACAAGCTGTGGAGGATATAAAGAGGCAGAGAGAAGAGGCGCAGAAACTCCTCAAGGAGGCTCTCGGAACCCTAGCTGG
GCAGTAG
AA sequence
>Potri.016G062800.1 pacid=42809465 polypeptide=Potri.016G062800.1.p locus=Potri.016G062800 ID=Potri.016G062800.1.v4.1 annot-version=v4.1
MATATFPPPPPFYRLYKDYIENPKSAPEPPPPIEGTYVCFASSYTTDDVLPSLEEQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYA
RRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRQREEAQKLLKEALGTLAGQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G03220 Mediator complex, subunit Med7... Potri.016G062800
[exp]
0 1
AT1G11680 EMB1738, CYP51A... embryo defective 1738, CYTOCHR... Potri.003G161700
[exp]
5.38 0.8797 CYP51G5,CYP51.1
AT2G28105 unknown protein Potri.004G215300
[exp]
13.19 0.8585
AT4G30220 RUXF small nuclear ribonucleoprotei... Potri.018G092200
[exp]
14.00 0.8538
AT3G14410 Nucleotide/sugar transporter f... Potri.001G394500
[exp]
14.14 0.8324
AT2G43360 BIOB, BIO2 BIOTIN AUXOTROPH B, BIOTIN AUX... Potri.017G033300
[exp]
16.43 0.8177 Pt-BIO2.2
AT2G26110 Protein of unknown function (D... Potri.018G053000
[exp]
17.00 0.8242
AT3G62060 Pectinacetylesterase family pr... Potri.014G110900
[exp]
19.39 0.8666
AT3G59540 Ribosomal L38e protein family ... Potri.008G076100
[exp]
27.94 0.8304
AT1G19580 GAMMACA1 ,GAMMA... gamma carbonic anhydrase 1 (.1... Potri.005G229000
[exp]
28.63 0.8497 APFI.2
AT4G34260 AXY8, FUC95A ALTERED XYLOGLUCAN 8, 1,2-alph... Potri.009G093900
[exp]
31.22 0.8281

Potri.016G062800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.