Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52360 87 / 4e-24 unknown protein AT2G35850 74 / 8e-19 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G200000 [exp] 140 / 3e-45 AT3G52360 89 / 9e-25 unknown protein Potri.006G069100 [exp] 44 / 1e-06 AT1G52565 67 / 7e-15 unknown protein Potri.018G131100 [exp] 37 / 0.0006 AT3G15760 75 / 5e-18 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016198 [exp] 77 / 2e-19 AT3G52360 59 / 2e-12 unknown protein Lus10029348 [exp] 74 / 2e-18 AT3G52360 55 / 5e-11 unknown protein Lus10013609 [exp] 63 / 4e-14 ND 37 / 3e-04 Lus10021242 [exp] 61 / 1e-13 ND 38 / 1e-04 Lus10019413 [exp] 39 / 0.0002 AT3G15760 61 / 7e-13 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G066200.1 pacid=42809217 polypeptide=Potri.016G066200.1.p locus=Potri.016G066200 ID=Potri.016G066200.1.v4.1 annot-version=v4.1 ATGCAAGGTTCGATGGGGCTTGGTTTCATGGCTGCCTTTGCCGTTTCAGGAAGTGTAGTTCTCATTGCACGTCAAGTCCACAAACGTCTCCTCTCTGATT TCATGAAGAAGATGGAATTTGAATTAGCGGGATCAAGGAGATCATGTCAAGACAGGAAGAGAGTGCGATTTGCAGATGATGTATTGGAGCCATCATCAAA TAACAAAGAGTACCGTAAGAGACACACCAAAGGAGACAACGAGGTCTTGAAAATGGAGGATTTTGTCCTAGACCAGAGTTTGATGGCGCAAAATTGTTAG
AA sequence Show only first row Show all	>Potri.016G066200.1 pacid=42809217 polypeptide=Potri.016G066200.1.p locus=Potri.016G066200 ID=Potri.016G066200.1.v4.1 annot-version=v4.1 MQGSMGLGFMAAFAVSGSVVLIARQVHKRLLSDFMKKMEFELAGSRRSCQDRKRVRFADDVLEPSSNNKEYRKRHTKGDNEVLKMEDFVLDQSLMAQNC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52360			unknown protein		Potri.016G066200 [exp]	0	1
AT1G77460			Armadillo/beta-catenin-like re...		Potri.002G081101 [exp]	2.82	0.9056
					Potri.017G145400 [exp]	5.83	0.9040
					Potri.017G149301 [exp]	12.40	0.8672
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Potri.019G118400 [exp]	13.56	0.8906
AT4G16146			cAMP-regulated phosphoprotein ...		Potri.008G108201 [exp]	21.16	0.8323
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.004G027900 [exp]	21.63	0.8266
AT5G37290			ARM repeat superfamily protein...		Potri.001G225300 [exp]	23.45	0.8425
					Potri.015G123750 [exp]	23.91	0.8497
AT1G07650			Leucine-rich repeat transmembr...		Potri.018G145536 [exp]	24.65	0.8260
AT4G32480			Protein of unknown function (D...		Potri.013G129900 [exp]	25.69	0.8608

Compare expression of checked genes

Potri.016G066200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.