Potri.016G067800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11780 156 / 1e-49 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
AT5G06480 150 / 5e-47 Immunoglobulin E-set superfamily protein (.1)
AT3G44100 135 / 2e-41 MD-2-related lipid recognition domain-containing protein (.1)
AT2G16005 59 / 1e-11 MD-2-related lipid recognition domain-containing protein (.1)
AT1G45015 47 / 5e-07 MD-2-related lipid recognition domain-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G201400 218 / 8e-74 AT3G11780 170 / 6e-55 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013596 157 / 5e-50 AT3G11780 181 / 2e-59 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
Lus10021256 155 / 4e-49 AT3G11780 183 / 4e-60 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
Lus10013366 153 / 3e-48 AT3G11780 161 / 1e-51 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0532 LIG PF02221 E1_DerP2_DerF2 ML domain
Representative CDS sequence
>Potri.016G067800.2 pacid=42810205 polypeptide=Potri.016G067800.2.p locus=Potri.016G067800 ID=Potri.016G067800.2.v4.1 annot-version=v4.1
ATGAAGATGGCTCTGTACAAGCTGATTGTAACTTTGCTCATCTCGCTTTGTCTGATCCTACCTTTGACTCAAGCCTCCAAATTCGAGTACTGCGGTAGCA
AGGATTATGCCGTTAAAGTTAGCGGGGTGAAGATAAGCCCGAATCCGGTGAAGAAAGGGAAACCAGCCACCTTCATCATCTCTGCAACCACAAGTGAAAC
AATTACTGGAGGGAAATTGAGAGTTGATGTTAGATACTTTGGATTTCCTGTGTATGGAGAGTATCATAATCTTTGTGAGGAGACATCGTGCCCTGTGAGT
GGTGGCGACTTTGTGGTGTCTCATTCCCAAGAGTTGCCTGGATTCACACCATCTGGTTCATACTCTCTTACTATGAAAATGGTTGATGGAGAAGGAGATG
AACTTACTTGCATTTCCTTTGGTTTTCACATTGGTTCTGCATCATCTGTTACTGATATTTAG
AA sequence
>Potri.016G067800.2 pacid=42810205 polypeptide=Potri.016G067800.2.p locus=Potri.016G067800 ID=Potri.016G067800.2.v4.1 annot-version=v4.1
MKMALYKLIVTLLISLCLILPLTQASKFEYCGSKDYAVKVSGVKISPNPVKKGKPATFIISATTSETITGGKLRVDVRYFGFPVYGEYHNLCEETSCPVS
GGDFVVSHSQELPGFTPSGSYSLTMKMVDGEGDELTCISFGFHIGSASSVTDI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G11780 MD-2-related lipid recognition... Potri.016G067800 0 1
AT3G48890 MSBP2, ATMP2, A... MEMBRANE STEROID BINDING PROTE... Potri.015G139800 4.58 0.6697 MP2.3
AT4G39220 ATRER1A Rer1 family protein (.1) Potri.009G118500 5.47 0.7120
AT4G36800 RCE1 RUB1 conjugating enzyme 1 (.1.... Potri.005G126500 8.24 0.7013
AT3G46200 ATNUDT9 nudix hydrolase homolog 9 (.1) Potri.009G026700 11.48 0.6639
AT1G02816 Protein of unknown function, D... Potri.013G014600 12.24 0.6547
AT1G21790 TRAM, LAG1 and CLN8 (TLC) lipi... Potri.005G178200 13.85 0.6098
AT5G10780 unknown protein Potri.018G016800 15.49 0.6129
AT3G58680 MBF1B, ATMBF1B multiprotein bridging factor 1... Potri.011G109500 21.56 0.6363
AT5G58710 ROC7 rotamase CYP 7 (.1) Potri.001G251700 23.36 0.6205 CYP5.2
AT1G75950 UIP1, SKP1A, AT... UFO INTERACTING PROTEIN 1, ARA... Potri.005G243100 23.43 0.6486 Pt-SKP1.3

Potri.016G067800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.