Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35910 128 / 1e-37 RING/U-box superfamily protein (.1) AT5G06490 120 / 1e-34 RING/U-box superfamily protein (.1) AT5G07040 89 / 1e-22 RING/U-box superfamily protein (.1) AT2G25409 86 / 2e-21 unknown protein AT4G40070 88 / 4e-21 RING/U-box superfamily protein (.1) AT5G27420 87 / 2e-20 CNI1, ATL31 carbon/nitrogen insensitive 1 (.1) AT5G53110 85 / 6e-20 RING/U-box superfamily protein (.1) AT2G25410 85 / 6e-20 RING/U-box superfamily protein (.1) AT2G46160 82 / 1e-19 RING/U-box superfamily protein (.1) AT3G05200 84 / 2e-19 ATL6 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G201500 [exp] 221 / 8e-75 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1) Potri.010G243400 [exp] 141 / 4e-43 AT2G35910 152 / 4e-47 RING/U-box superfamily protein (.1) Potri.008G019000 [exp] 127 / 1e-37 AT5G06490 131 / 8e-39 RING/U-box superfamily protein (.1) Potri.010G243200 [exp] 126 / 4e-37 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1) Potri.008G018900 [exp] 123 / 3e-36 AT2G35910 100 / 2e-26 RING/U-box superfamily protein (.1) Potri.010G243500 [exp] 115 / 5e-33 AT5G06490 113 / 6e-32 RING/U-box superfamily protein (.1) Potri.010G243300 [exp] 108 / 1e-30 AT2G35910 115 / 2e-32 RING/U-box superfamily protein (.1) Potri.014G091000 [exp] 88 / 4e-22 AT3G61550 176 / 1e-55 RING/U-box superfamily protein (.1) Potri.002G165200 [exp] 87 / 6e-22 AT3G61550 204 / 5e-67 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041079 [exp] 90 / 1e-22 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1) Lus10003400 [exp] 84 / 8e-21 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1) Lus10024124 [exp] 84 / 2e-20 AT5G07040 190 / 2e-62 RING/U-box superfamily protein (.1) Lus10005389 [exp] 82 / 4e-20 AT5G07040 154 / 9e-49 RING/U-box superfamily protein (.1) Lus10031515 [exp] 85 / 5e-20 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1) Lus10015167 [exp] 85 / 7e-20 AT3G05200 226 / 2e-71 RING/U-box superfamily protein (.1) Lus10034153 [exp] 80 / 4e-19 AT2G17450 79 / 2e-18 RING-H2 finger A3A (.1) Lus10000333 [exp] 83 / 7e-19 AT3G05200 309 / 2e-102 RING/U-box superfamily protein (.1) Lus10019018 [exp] 82 / 7e-19 AT5G53110 332 / 4e-112 RING/U-box superfamily protein (.1) Lus10004460 [exp] 81 / 4e-18 AT3G05200 307 / 6e-102 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.016G067900.1 pacid=42809728 polypeptide=Potri.016G067900.1.p locus=Potri.016G067900 ID=Potri.016G067900.1.v4.1 annot-version=v4.1 ATGAATAGCACAACAGGGTATACTGGACTTCTTGGCTCCAATAACATTGGTGGATTTGGCTATGGCATTGGTGTATCTATTGGAATCCTGCTGCTCATTA CAACAATCACTTTGGCCTCCTATTTTTGCGCACGAAACCAGCAGACGTCGGTGCCAAGCCAGGGAAGAAATTCTGCAGATCAGCAACTGAACCTGCAAAG CTTTGTTGTTGAAATAGGGCTCGATGAGGCCACTCTAAAGAGCTATCCTACACTTCTGTATTCGGAGGCCAAGCTACACAAGACAGACTCCACTTCTACA TGCTGCTCCATATGCTTGGCAGATTACAAGAGCACTGATAAACTAAGGTTGCTGCCGGATTGCGGACATCTCTTTCACCTCAAGTGTGTTGACCCGTGGT TGAGGCTGCACCCAACTTGTCCAGTCTGTAGAACATCTCCATTGCCTACACCCCTCGCAACCCCTCTGGCTGAGGTTGTTCCACTGGCAAGCAGGCGGGA TTGA
AA sequence Show only first row Show all	>Potri.016G067900.1 pacid=42809728 polypeptide=Potri.016G067900.1.p locus=Potri.016G067900 ID=Potri.016G067900.1.v4.1 annot-version=v4.1 MNSTTGYTGLLGSNNIGGFGYGIGVSIGILLLITTITLASYFCARNQQTSVPSQGRNSADQQLNLQSFVVEIGLDEATLKSYPTLLYSEAKLHKTDSTST CCSICLADYKSTDKLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTSPLPTPLATPLAEVVPLASRRD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35910			RING/U-box superfamily protein...		Potri.016G067900 [exp]	0	1
AT2G35910			RING/U-box superfamily protein...		Potri.006G201500 [exp]	1.00	0.8862
AT3G45400			exostosin family protein (.1)		Potri.019G044600 [exp]	7.34	0.8725
AT3G55420			unknown protein		Potri.010G203900 [exp]	7.74	0.8509
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Potri.001G065900 [exp]	8.48	0.8631
AT1G15670			Galactose oxidase/kelch repeat...		Potri.001G178500 [exp]	9.16	0.8501
AT3G13275			unknown protein		Potri.001G469401 [exp]	9.48	0.8754
AT1G01780	LIM	PLIM2b	PLIM2b, GATA type zinc finger ...		Potri.002G157300 [exp]	11.48	0.8654
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.005G182700 [exp]	11.83	0.8546	ACO4
AT1G05020			ENTH/ANTH/VHS superfamily prot...		Potri.014G158600 [exp]	14.31	0.7660
AT3G54880			unknown protein		Potri.010G227800 [exp]	16.12	0.8696

Compare expression of checked genes

Potri.016G067900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.