Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70600 268 / 7e-94 Ribosomal protein L18e/L15 superfamily protein (.1) AT1G23290 261 / 4e-91 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1) AT1G12960 133 / 3e-41 Ribosomal protein L18e/L15 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G045800 [exp] 295 / 8e-105 AT1G70600 237 / 1e-81 Ribosomal protein L18e/L15 superfamily protein (.1) Potri.008G187000 [exp] 293 / 1e-103 AT1G70600 238 / 3e-82 Ribosomal protein L18e/L15 superfamily protein (.1) Potri.006G202300 [exp] 292 / 2e-103 AT1G70600 238 / 5e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039528 [exp] 276 / 3e-97 AT1G70600 264 / 2e-92 Ribosomal protein L18e/L15 superfamily protein (.1) Lus10024161 [exp] 275 / 2e-96 AT1G70600 263 / 6e-92 Ribosomal protein L18e/L15 superfamily protein (.1) Lus10036855 [exp] 270 / 2e-94 AT1G70600 255 / 8e-89 Ribosomal protein L18e/L15 superfamily protein (.1) Lus10006207 [exp] 269 / 2e-94 AT1G70600 254 / 1e-88 Ribosomal protein L18e/L15 superfamily protein (.1) Lus10004617 [exp] 268 / 7e-94 AT1G23290 258 / 5e-90 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1) Lus10026698 [exp] 265 / 9e-93 AT1G23290 256 / 2e-89 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1) Lus10016336 [exp] 263 / 5e-92 AT1G23290 253 / 3e-88 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0588 [poplar] [flax] Ribos_L15p_L18e PF00828 [poplar] [flax] Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence Show only first row Show all	>Potri.016G069000.1 pacid=42809893 polypeptide=Potri.016G069000.1.p locus=Potri.016G069000 ID=Potri.016G069000.1.v4.1 annot-version=v4.1 ATGACAACCCGCTTCAAGAAGAACCGGAAGAAGAGAGGTCACGTGAGCGCTGGTCATGGTCGTATCGGAAAGCACAGGAAGCACCCTGGAGGTCGCGGAA ATGCAGGAGGCATGCACCACCACAGGATCCTCTTCGACAAATACCATCCTGGTTACTTCGGTAAGGTCGGTATGCGCTACTTCCACAAGCTCCGCAACAA ATTCCACTGTCCCATTGTCAACATCGACAAGCTCTGGTCCATGGTCCCACAAGACGTCAAAGACAAGGCAACCAAGGATACTGTGCCCATGATTGATGTC ACTCAGTTTGGTTACTTCAAGGTTCTTGGTAAGGGGGTTTTGCCTGAGAAGCAACCCATTGTTGTCAAGGCCAAGCTTGTGTCAAAGATTGCTGAGAAGA AGATTAAGGAGGCTGGTGGAGCTGTTGTTCTTACAGCCTAG
AA sequence Show only first row Show all	>Potri.016G069000.1 pacid=42809893 polypeptide=Potri.016G069000.1.p locus=Potri.016G069000 ID=Potri.016G069000.1.v4.1 annot-version=v4.1 MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFHCPIVNIDKLWSMVPQDVKDKATKDTVPMIDV TQFGYFKVLGKGVLPEKQPIVVKAKLVSKIAEKKIKEAGGAVVLTA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.016G069000 [exp]	0	1
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.002G051300 [exp]	1.00	0.9668
AT3G57490			Ribosomal protein S5 family pr...		Potri.006G052400 [exp]	1.41	0.9588	Pt-RPS2.2
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Potri.012G114000 [exp]	4.47	0.9558
AT2G18110			Translation elongation factor...		Potri.015G094200 [exp]	5.09	0.9493	Pt-EEF1.1
AT2G27530		PGY1	PIGGYBACK1, Ribosomal protein ...		Potri.007G034800 [exp]	7.34	0.9550
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.008G187000 [exp]	8.24	0.9562
AT5G09500			Ribosomal protein S19 family p...		Potri.005G219700 [exp]	8.83	0.9577
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Potri.015G111500 [exp]	9.38	0.9531	Pt-UBI.4
AT1G18080		RACK1A_AT, ATAR...	RECEPTOR FOR ACTIVATED C KINAS...		Potri.012G052700 [exp]	9.48	0.9529	Pt-GBF1.3
AT2G41840			Ribosomal protein S5 family pr...		Potri.016G055000 [exp]	10.48	0.9497	Pt-RPS2.3

Compare expression of checked genes

Potri.016G069000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.