Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	NHL1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11660 272 / 1e-93 NHL1 NDR1/HIN1-like 1 (.1) AT3G52470 256 / 2e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35960 247 / 1e-83 NHL12 NDR1/HIN1-like 12 (.1) AT5G06330 238 / 4e-80 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G44220 230 / 3e-77 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35970 214 / 2e-70 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G09590 210 / 5e-69 NHL22 NDR1/HIN1-like 22 (.1) AT5G22200 209 / 2e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G53730 144 / 5e-43 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G05657 109 / 1e-30 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G204200 [exp] 311 / 4e-109 AT3G11660 267 / 1e-91 NDR1/HIN1-like 1 (.1) Potri.009G019600 [exp] 216 / 1e-71 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.005G088000 [exp] 177 / 2e-56 AT3G44220 194 / 5e-63 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G006000 [exp] 148 / 8e-45 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G002400 [exp] 143 / 9e-43 AT5G53730 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G106100 [exp] 108 / 3e-29 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G180000 [exp] 105 / 2e-28 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 74 / 5e-16 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G145500 [exp] 71 / 1e-14 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021286 [exp] 293 / 5e-102 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 287 / 2e-99 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1) Lus10004202 [exp] 225 / 6e-75 AT3G11660 257 / 8e-88 NDR1/HIN1-like 1 (.1) Lus10029406 [exp] 220 / 6e-73 AT3G11660 252 / 7e-86 NDR1/HIN1-like 1 (.1) Lus10043410 [exp] 174 / 1e-54 AT3G44220 207 / 6e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034175 [exp] 164 / 1e-50 AT3G44220 210 / 7e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10000157 [exp] 153 / 7e-47 AT3G52470 164 / 3e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10013327 [exp] 130 / 2e-37 AT3G11660 147 / 2e-44 NDR1/HIN1-like 1 (.1) Lus10032932 [exp] 124 / 3e-35 AT5G53730 211 / 4e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10030193 [exp] 100 / 9e-26 AT4G01410 185 / 3e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.016G071500.1 pacid=42810266 polypeptide=Potri.016G071500.1.p locus=Potri.016G071500 ID=Potri.016G071500.1.v4.1 annot-version=v4.1 ATGTCATCCAAAGACTGCGGCAGCCACGGCCACAGACGCCGAAAAATCTTCCGTCGAATCTTCGCCGGAATCCTAATCTTCCTCCTCATAGTCCTCATCA TAATTCTCTTAGTTTGGGCCATCCTCCGTCCTTCAAAACCAAAATTCATCCTCCAAGATGCTACAGTTTACGCCTTCAACGTTTCATCTCCAAATGTTCT CACTTCCAACTTCCAAGTCACCTTATCCTCTCGCAACCCCAATGACAAAGTCGGGATCTACTATGATAAACTCGATGTTTATGCCACATACCGTAACCAA CAAATAACTCTACGTACTTCCATACCTACTTCTTACCAAGGACACAAAGAAATTGATGTTTGGTCCCCTTTTATCTACGGCAGCGCCGTGCCTGTATCTC CGTACAATTCAGTTGCATTAAGTCAAGACCAAGCTACAGGAACTGTGTTGCTGATGATCAAGATTGATGGTCGTGTCCGATTCAAAGTTGGAACCTTTAT TTCTGCGAAATATCATTTGAATGTTCGGTGTCCTGCTTATATTCAGTTTGGTAGCAGAACCAGTGGAATCATTGTCGGTGAGAACGCCATTAAGTATCAG CTGGTAACGAGATGCAGTGTGAGCCTTTGA
AA sequence Show only first row Show all	>Potri.016G071500.1 pacid=42810266 polypeptide=Potri.016G071500.1.p locus=Potri.016G071500 ID=Potri.016G071500.1.v4.1 annot-version=v4.1 MSSKDCGSHGHRRRKIFRRIFAGILIFLLIVLIIILLVWAILRPSKPKFILQDATVYAFNVSSPNVLTSNFQVTLSSRNPNDKVGIYYDKLDVYATYRNQ QITLRTSIPTSYQGHKEIDVWSPFIYGSAVPVSPYNSVALSQDQATGTVLLMIKIDGRVRFKVGTFISAKYHLNVRCPAYIQFGSRTSGIIVGENAIKYQ LVTRCSVSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G11660		NHL1	NDR1/HIN1-like 1 (.1)		Potri.016G071500 [exp]	0	1	NHL1.1
AT1G23040			hydroxyproline-rich glycoprote...		Potri.010G113300 [exp]	1.00	0.7699
AT1G23040			hydroxyproline-rich glycoprote...		Potri.008G129100 [exp]	8.94	0.6469
AT1G66810	C3HZnF	AtC3H14	Zinc finger C-x8-C-x5-C-x3-H t...		Potri.005G176900 [exp]	9.48	0.6908
AT5G02270		ABCI20, ATNAP9	ARABIDOPSIS THALIANA NON-INTRI...		Potri.003G155800 [exp]	12.16	0.7050
AT3G20920			translocation protein-related ...		Potri.001G257500 [exp]	18.65	0.6886
AT4G14240			CBS domain-containing protein ...		Potri.010G030200 [exp]	24.00	0.5968
AT5G42090			Lung seven transmembrane recep...		Potri.001G083100 [exp]	30.09	0.6633
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.001G335100 [exp]	30.98	0.5765
AT5G53300		UBC10	ubiquitin-conjugating enzyme 1...		Potri.015G023300 [exp]	33.46	0.6354	Pt-UBC.4
AT5G16760		AtITPK1	inositol \(1,3,4\) P3 5/6-kina...		Potri.019G047200 [exp]	42.74	0.5897

Compare expression of checked genes

Potri.016G071500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.