Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35980 206 / 5e-67 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06320 159 / 2e-48 NHL3 NDR1/HIN1-like 3 (.1) AT3G11650 154 / 8e-47 NHL2 NDR1/HIN1-like 2 (.1) AT2G35460 144 / 1e-42 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G32270 105 / 2e-26 ATSYP24 SYNTAXIN 24, syntaxin, putative (.1) AT5G06330 79 / 8e-18 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11660 77 / 3e-17 NHL1 NDR1/HIN1-like 1 (.1) AT4G05220 76 / 1e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G53730 75 / 3e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G36970 73 / 2e-15 NHL25 NDR1/HIN1-like 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G204300 [exp] 327 / 4e-115 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G145500 [exp] 84 / 2e-19 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1) Potri.015G148200 [exp] 82 / 2e-18 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1) Potri.009G003800 [exp] 76 / 1e-16 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071500 [exp] 74 / 3e-16 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.006G204200 [exp] 72 / 3e-15 AT3G11660 267 / 1e-91 NDR1/HIN1-like 1 (.1) Potri.002G180000 [exp] 71 / 7e-15 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023300 [exp] 70 / 2e-14 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G106100 [exp] 69 / 2e-14 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021287 [exp] 220 / 2e-72 AT2G35980 236 / 7e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 217 / 2e-71 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016962 [exp] 199 / 2e-64 AT2G35980 237 / 3e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021286 [exp] 75 / 2e-16 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10043411 [exp] 74 / 9e-16 AT2G27260 148 / 6e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034173 [exp] 74 / 1e-15 AT2G27260 149 / 2e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007364 [exp] 74 / 2e-15 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 72 / 4e-15 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1) Lus10020783 [exp] 72 / 8e-15 AT5G36970 229 / 2e-75 NDR1/HIN1-like 25 (.1) Lus10037638 [exp] 70 / 4e-14 AT1G17620 201 / 4e-64 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.016G071600.2 pacid=42808950 polypeptide=Potri.016G071600.2.p locus=Potri.016G071600 ID=Potri.016G071600.2.v4.1 annot-version=v4.1 ATGGCAGATAAACAAGGCCTGAATGGCGCCTATTATGGTCCAAAAATCCCACCTACACAACAGTACCACCGCCCTGGCCGTGGTTCTGACTGTGGCTGCT GCTGTCTCGTGACCCTCCTCCTCAAAGTGATCATCACCGTGCTCACGCTTATTGGCCTCTTCGTTCTTATTGTCTGGCTCATATTCCGTCCCATTAACAA GGTCAAGTTTCATGTCACGGACGTTGCTTTAACCGAGTTCAACTACAGTACCAACAACACCATGCTCCGCTACAACCTTGCTTTTAACGTCAGCATCCGC AACCCCAACAAGAAGATTGGAATTTACTATAACAGGGTAGAGGCCAAAGCCTTTTATGAGGGCCAGAGGTTTGGTTATAGTTCCTTGACTCCGTTCTATC AAGGACACAAGAACACTACTGTCTTGAATGTGGTTTTTACTGGTACACAACCTGTTACCCTTCAAGGTGAAGATTTGAAGCAATTTAACAGCGAAAAAAC AAGTGGGCTTTATAGTATTGCCTTGGAGTTGTCTTTGAGGGTTAAGTTCAAGCTTGGTAAGGTCAAGACTGCAAGATTCAAGCCCAAGGTTGAGTGTGAT GACTTGAAGATTCGTTTGAACGGGCCTTCTGTTGCTGAGAGTAACAACAAGTGCAAGATCAAGTTCTGA
AA sequence Show only first row Show all	>Potri.016G071600.2 pacid=42808950 polypeptide=Potri.016G071600.2.p locus=Potri.016G071600 ID=Potri.016G071600.2.v4.1 annot-version=v4.1 MADKQGLNGAYYGPKIPPTQQYHRPGRGSDCGCCCLVTLLLKVIITVLTLIGLFVLIVWLIFRPINKVKFHVTDVALTEFNYSTNNTMLRYNLAFNVSIR NPNKKIGIYYNRVEAKAFYEGQRFGYSSLTPFYQGHKNTTVLNVVFTGTQPVTLQGEDLKQFNSEKTSGLYSIALELSLRVKFKLGKVKTARFKPKVECD DLKIRLNGPSVAESNNKCKIKF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Potri.016G071600 [exp]	0	1
AT3G27320			alpha/beta-Hydrolases superfam...		Potri.008G180500 [exp]	1.00	0.9582
AT4G39670			Glycolipid transfer protein (G...		Potri.008G119600 [exp]	1.41	0.9548
AT4G04450	WRKY	ATWRKY42, WRKY4...	WRKY family transcription fact...		Potri.004G007500 [exp]	3.46	0.9372	Pt-WRKY6.1
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Potri.010G108800 [exp]	3.87	0.9511
AT1G07570		APK1A	Protein kinase superfamily pro...		Potri.008G056400 [exp]	4.24	0.9308
AT1G77810			Galactosyltransferase family p...		Potri.002G089800 [exp]	4.47	0.9442
AT4G09760			Protein kinase superfamily pro...		Potri.005G197500 [exp]	5.38	0.9099
AT5G13080	WRKY	ATWRKY75, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Potri.003G169100 [exp]	7.74	0.9389
AT5G61210		SNP33, ATSNAP33...	soluble N-ethylmaleimide-sensi...		Potri.015G049000 [exp]	8.24	0.9174
AT5G61820			unknown protein		Potri.015G108500 [exp]	8.94	0.9317

Compare expression of checked genes

Potri.016G071600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.