Plant FIBer expression Database

Potri.016G072851 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.016G072851.1 pacid=42809980 polypeptide=Potri.016G072851.1.p locus=Potri.016G072851 ID=Potri.016G072851.1.v4.1 annot-version=v4.1
ATGATGATGGCTTTTTTTCAATTTATTTCTAATTATTTTTCTATAAAGAACGAGAGAACCCACAAAACCTTACGAAAAGGACCAGCTGAAGATGGAATCT
ATCGAATTCCTTGGATCGCACTACCGTCACTTCAACAAGGAGCAAAAACCATCATCAGAGTGAGAATCAGCTTGGAGGATTGGCAGGCGGGTTTGGGAAG
TCTGCAATTTCCATCAGTCTTATCTGTTATCAAGAATTTCCAGTTGCCTTGTTCTAATTCCCTAAAAGTATCTAAGCAAAAATGTACTTTATATTGCTTA
GGGAAGTTTAGTAGGATTACTCTACCTGGTACAGGATCACTTACAAATGAACCATTATCCTTAGTTCATGTTGATTTCTAG
AA sequence
>Potri.016G072851.1 pacid=42809980 polypeptide=Potri.016G072851.1.p locus=Potri.016G072851 ID=Potri.016G072851.1.v4.1 annot-version=v4.1
MMMAFFQFISNYFSIKNERTHKTLRKGPAEDGIYRIPWIALPSLQQGAKTIIRVRISLEDWQAGLGSLQFPSVLSVIKNFQLPCSNSLKVSKQKCTLYCL
GKFSRITLPGTGSLTNEPLSLVHVDF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G072851
[exp]
0 1
AT5G44680 DNA glycosylase superfamily pr... Potri.001G074700
[exp]
8.54 0.9496
AT3G04290 ATLTL1, LTL1 Li-tolerant lipase 1 (.1) Potri.019G024400
[exp]
17.83 0.9429
AT4G25960 ABCB2, PGP2 ATP-binding cassette B2, P-gly... Potri.003G094400
[exp]
18.52 0.9381
AT1G29430 SAUR-like auxin-responsive pro... Potri.009G141251
[exp]
18.73 0.9254
AT3G52500 Eukaryotic aspartyl protease f... Potri.009G162400
[exp]
27.29 0.9404
AT4G38840 SAUR-like auxin-responsive pro... Potri.009G126700
[exp]
29.52 0.9414
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Potri.019G093900
[exp]
30.00 0.9389
AT2G46640 unknown protein Potri.014G102600
[exp]
32.83 0.9283
AT3G17210 ATHS1 A. THALIANA HEAT STABLE PROTEI... Potri.010G151200
[exp]
36.11 0.9375 SP1.2
AT3G57800 bHLH bHLH060 basic helix-loop-helix (bHLH) ... Potri.016G051100
[exp]
44.49 0.9338

Potri.016G072851 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.