Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22280 93 / 8e-26 unknown protein AT5G06265 81 / 5e-21 hyaluronan mediated motility receptor-related (.1.2.3) AT3G44280 63 / 5e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G206100 [exp] 156 / 4e-51 AT5G22280 72 / 2e-17 unknown protein Potri.004G200200 [exp] 72 / 7e-18 AT5G22280 101 / 3e-29 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016983 [exp] 108 / 5e-32 AT5G22280 76 / 4e-19 unknown protein Lus10043403 [exp] 94 / 3e-26 AT5G22280 127 / 3e-39 unknown protein Lus10034182 [exp] 47 / 3e-08 AT5G22280 77 / 2e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G073500.3 pacid=42809273 polypeptide=Potri.016G073500.3.p locus=Potri.016G073500 ID=Potri.016G073500.3.v4.1 annot-version=v4.1 ATGGCGAGACCGTGGGTACTGGTCTCTTTGCTATTGTTAATTGTGTTCACGTCTCAGTTAGAGTGGAAACAACAATTTGGTAATGAAATTGAAGCAAGTC CAAACATTTCCCAGAGAGACCAACAACAACATAGTTCGAATCGAGAAGAAGTTGTCAAAGAAAAGATAATCCTTTCTCAAGAAAAGAACATTCAGAAACT TAATGAGCTTGTCCAGAGTCTCCGAGAACAGTTGCAGCACTGTAGGAGTGAAAATTACATTGTCAACAGCACTGCAATCCCTTTGACTGAACATCTAAAT GGAGTTTGA
AA sequence Show only first row Show all	>Potri.016G073500.3 pacid=42809273 polypeptide=Potri.016G073500.3.p locus=Potri.016G073500 ID=Potri.016G073500.3.v4.1 annot-version=v4.1 MARPWVLVSLLLLIVFTSQLEWKQQFGNEIEASPNISQRDQQQHSSNREEVVKEKIILSQEKNIQKLNELVQSLREQLQHCRSENYIVNSTAIPLTEHLN GV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G22280			unknown protein		Potri.016G073500 [exp]	0	1
AT4G13520		SMAP1	small acidic protein 1 (.1)		Potri.008G174000 [exp]	1.41	0.8516
AT5G49550		BLOS2	BLOC subunit 2, unknown protei...		Potri.017G106200 [exp]	3.46	0.7761
AT1G71750		HGPT	Hypoxanthine-guanine phosphori...		Potri.005G198400 [exp]	4.69	0.8367
AT4G09830			Uncharacterised conserved prot...		Potri.005G196400 [exp]	6.92	0.8214
AT3G62840			Small nuclear ribonucleoprotei...		Potri.002G204300 [exp]	7.74	0.7667
AT5G62950			RNA polymerase II, Rpb4, core ...		Potri.005G067600 [exp]	8.83	0.8344
AT4G14660		NRPE7	RNA polymerase Rpb7-like, N-te...		Potri.010G077300 [exp]	10.95	0.7911
AT4G13520		SMAP1	small acidic protein 1 (.1)		Potri.010G063100 [exp]	11.22	0.7720
AT2G44065			Ribosomal protein L2 family (....		Potri.007G142200 [exp]	11.35	0.7273
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Potri.011G109500 [exp]	12.84	0.7181

Compare expression of checked genes

Potri.016G073500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.