Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04800 171 / 2e-56 Ribosomal S17 family protein (.1.2.3.4) AT2G04390 170 / 1e-55 Ribosomal S17 family protein (.1) AT2G05220 169 / 2e-55 Ribosomal S17 family protein (.1.2) AT3G10610 167 / 2e-54 Ribosomal S17 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G017300 [exp] 175 / 7e-58 AT5G04800 229 / 1e-78 Ribosomal S17 family protein (.1.2.3.4) Potri.010G241200 [exp] 173 / 8e-57 AT5G04800 228 / 2e-78 Ribosomal S17 family protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021307 [exp] 174 / 3e-57 AT5G04800 231 / 9e-80 Ribosomal S17 family protein (.1.2.3.4) Lus10004208 [exp] 171 / 3e-56 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1) Lus10029412 [exp] 171 / 3e-56 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1) Lus10041076 [exp] 170 / 1e-55 AT5G04800 226 / 8e-78 Ribosomal S17 family protein (.1.2.3.4) Lus10030344 [exp] 173 / 3e-52 AT1G80560 655 / 0.0 ARABIDOPSIS ISOPROPYLMALATE DEHYDROGENASE 2, isopropylmalate dehydrogenase 2 (.1) Lus10016985 [exp] 91 / 1e-24 AT3G10610 143 / 1e-45 Ribosomal S17 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00833 [poplar] [flax] Ribosomal_S17e Ribosomal S17
Representative CDS sequence Show only first row Show all	>Potri.016G073750.1 pacid=42809444 polypeptide=Potri.016G073750.1.p locus=Potri.016G073750 ID=Potri.016G073750.1.v4.1 annot-version=v4.1 ATGACCCTCGATTTCCATACCAACAAGAAGGCCCTTGAGGAGGTAGCAATCATCCCATCAAAGCGTCCTCGCAACAAGATTGCTGGGTTCTCCACTCACT TAATGAAACAGATCCAGAAGGGTCCTGTCCGAGGGATTTCTCTAAAGCTTCAAGAGGAAGAACGTGAGCGCCGCATGGACTTTGTGCCTGAAGTGTCTGC CATCAAGAGTGATCAGATTGAGGTTGATAAGGAGACCATGGACATGCTTGCTTCTCTTGGTATGTCTTGTTTTCCTGGGCTTGTACAGGTTGACCCGTTG CTATATATACCCGTTACACAGTTCGGGTTTCGAAGAGGCGGTCCTGGTGGGTTTGCGAGGAGAGGTTAA
AA sequence Show only first row Show all	>Potri.016G073750.1 pacid=42809444 polypeptide=Potri.016G073750.1.p locus=Potri.016G073750 ID=Potri.016G073750.1.v4.1 annot-version=v4.1 MTLDFHTNKKALEEVAIIPSKRPRNKIAGFSTHLMKQIQKGPVRGISLKLQEEERERRMDFVPEVSAIKSDQIEVDKETMDMLASLGMSCFPGLVQVDPL LYIPVTQFGFRRGGPGGFARRG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04800			Ribosomal S17 family protein (...		Potri.016G073750 [exp]	0	1
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.011G005200 [exp]	1.41	0.9013
					Potri.012G067350 [exp]	5.65	0.8993
AT1G61250		SC3	secretory carrier 3 (.1.2)		Potri.004G036600 [exp]	16.94	0.8589
AT4G14010		RALFL32	ralf-like 32 (.1)		Potri.001G321300 [exp]	20.19	0.8416
AT3G29180			Protein of unknown function (D...		Potri.017G088000 [exp]	23.76	0.8644
AT4G30420			nodulin MtN21 /EamA-like trans...		Potri.006G177600 [exp]	26.72	0.8467
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.001G064301 [exp]	32.24	0.8107
AT3G21610			Acid phosphatase/vanadium-depe...		Potri.014G156000 [exp]	33.91	0.8420
AT2G28370			Uncharacterised protein family...		Potri.004G211400 [exp]	34.46	0.8372
AT4G27220			NB-ARC domain-containing disea...		Potri.011G127200 [exp]	39.47	0.8451

Compare expression of checked genes

Potri.016G073750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.