Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22380 214 / 1e-69 NAC ANAC090 NAC domain containing protein 90 (.1) AT3G44350 209 / 1e-67 NAC ANAC061 NAC domain containing protein 61 (.1.2) AT2G17040 146 / 1e-42 NAC ANAC036 NAC domain containing protein 36 (.1) AT3G17730 136 / 4e-39 NAC ANAC057 NAC domain containing protein 57 (.1) AT1G65910 143 / 6e-39 NAC ANAC028 NAC domain containing protein 28 (.1) AT4G27410 135 / 4e-38 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT2G02450 136 / 9e-38 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT1G69490 131 / 5e-37 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT5G08790 131 / 8e-37 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G17980 130 / 8e-37 NAC ANAC071 NAC domain containing protein 71 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G209200 [exp] 280 / 4e-95 AT5G22380 241 / 3e-80 NAC domain containing protein 90 (.1) Potri.016G076000 [exp] 278 / 2e-94 AT5G22380 226 / 4e-74 NAC domain containing protein 90 (.1) Potri.001G218800 [exp] 245 / 2e-81 AT5G22380 272 / 3e-92 NAC domain containing protein 90 (.1) Potri.009G019200 [exp] 234 / 2e-77 AT3G44350 257 / 1e-86 NAC domain containing protein 61 (.1.2) Potri.008G081500 [exp] 140 / 1e-39 AT1G54330 316 / 1e-107 NAC domain containing protein 20 (.1) Potri.010G174600 [exp] 139 / 2e-39 AT1G54330 290 / 2e-97 NAC domain containing protein 20 (.1) Potri.009G141600 [exp] 138 / 2e-39 AT2G17040 314 / 6e-108 NAC domain containing protein 36 (.1) Potri.003G089800 [exp] 139 / 5e-39 AT4G17980 319 / 6e-109 NAC domain containing protein 71 (.1) Potri.003G046700 [exp] 139 / 1e-38 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020643 [exp] 235 / 1e-77 AT5G22380 283 / 1e-96 NAC domain containing protein 90 (.1) Lus10004846 [exp] 228 / 5e-75 AT5G22380 275 / 1e-93 NAC domain containing protein 90 (.1) Lus10029410 [exp] 201 / 4e-64 AT5G22380 171 / 1e-52 NAC domain containing protein 90 (.1) Lus10026617 [exp] 138 / 2e-39 AT1G69490 298 / 1e-101 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10042284 [exp] 137 / 5e-39 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10008420 [exp] 139 / 6e-39 AT2G02450 320 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10026373 [exp] 137 / 6e-39 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1) Lus10020794 [exp] 143 / 1e-38 AT5G10360 449 / 8e-153 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2) Lus10007377 [exp] 142 / 2e-38 AT1G65910 431 / 7e-143 NAC domain containing protein 28 (.1) Lus10008419 [exp] 139 / 2e-38 AT2G02450 327 / 7e-109 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.016G076100.1 pacid=42809907 polypeptide=Potri.016G076100.1.p locus=Potri.016G076100 ID=Potri.016G076100.1.v4.1 annot-version=v4.1 ATGGTTTTTCCACCAGGTTATCGTTTCTTCCCTACCGAAGAAGAGCTGATCTCGTTTTATCTTCACCACAAGCTAGATGGCGGGAGTGAAGACCTTAACC AGGTCATTAACCAGATTATACCGGTCCGTGATATATACGAGCACGATCCATGGGATCTTCCACAATTTTCAGGAGGCTTGCACCATATTAAAGATCCTGA GCAGTGGTTTTTCTTCATTCCAAGACAAGAGAGCGAAGCTCGTGGAGGGAGGCCTAAGAGACTAACAAATACTGGATACTGGAAAGCAACTGGCTCTCCA GGGTCTGTCTTTTCCAACAATCGCAGCATTGGTTTGAAAAGAACAATGGTTTTCTATAGCGGAAGGGCTCCAAATGGAAGAAAAACTGAGTGGAAAATGA ACGAGTACAAAGCTATAGATCAAGGGAAAGCATCCTCATCAACTAGCGCAAATCCAAAGTTAAGGCATGAATACAGTTTGTGCCGGGTCTACAAAAACTC AAAATCCATGCGAGCATTCGACAGACGGCCGGTGGGCCTTGAGGTAATCGAGCCAAGAACTCAACCAGCCTCTGGTGGCAATGAGCTAGTAGCATCTGAT CAAAACCATCCAACAGTGGAGAACACAAGCTCACCTGACAGTTCATGGTCCGCAGACCAAGGCAATCCCTCTGGAACTGGTGAGAGTAGTAGCATGCCAA TGCCTATCGATAATGCTATGTGGGATGTGGACTTAGATTGGTACTACGGCGCCGGACAGGATTAA
AA sequence Show only first row Show all	>Potri.016G076100.1 pacid=42809907 polypeptide=Potri.016G076100.1.p locus=Potri.016G076100 ID=Potri.016G076100.1.v4.1 annot-version=v4.1 MVFPPGYRFFPTEEELISFYLHHKLDGGSEDLNQVINQIIPVRDIYEHDPWDLPQFSGGLHHIKDPEQWFFFIPRQESEARGGRPKRLTNTGYWKATGSP GSVFSNNRSIGLKRTMVFYSGRAPNGRKTEWKMNEYKAIDQGKASSSTSANPKLRHEYSLCRVYKNSKSMRAFDRRPVGLEVIEPRTQPASGGNELVASD QNHPTVENTSSPDSSWSADQGNPSGTGESSSMPMPIDNAMWDVDLDWYYGAGQD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Potri.016G076100 [exp]	0	1
AT1G01490			Heavy metal transport/detoxifi...		Potri.017G147400 [exp]	1.73	0.9429
AT3G18670			Ankyrin repeat family protein ...		Potri.015G125000 [exp]	1.73	0.9481
AT2G17040	NAC	ANAC036	NAC domain containing protein ...		Potri.009G141600 [exp]	2.00	0.9465
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.013G106200 [exp]	2.82	0.9424
AT5G07610			F-box family protein (.1)		Potri.010G254000 [exp]	8.88	0.8730
AT3G07600			Heavy metal transport/detoxifi...		Potri.014G171300 [exp]	9.89	0.9200
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Potri.016G137900 [exp]	10.39	0.8612
AT3G48090		ATEDS1, EDS1	enhanced disease susceptibilit...		Potri.015G069600 [exp]	10.58	0.9172	EDS1.2
AT4G39670			Glycolipid transfer protein (G...		Potri.008G119600 [exp]	10.58	0.9339
AT2G43000	NAC	ANAC042, JUB1, ...	NAC domain containing protein ...		Potri.001G080900 [exp]	13.96	0.9377

Compare expression of checked genes

Potri.016G076100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.