Potri.016G076500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1)
AT5G15200 347 / 1e-123 Ribosomal protein S4 (.1.2)
AT5G15750 43 / 3e-05 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
ATCG00380 42 / 6e-05 ATCG00380.1, RPS4 chloroplast ribosomal protein S4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G076800 380 / 8e-137 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1)
Potri.018G062300 374 / 3e-134 AT5G39850 332 / 1e-117 Ribosomal protein S4 (.1)
Potri.006G209700 365 / 1e-130 AT5G39850 325 / 6e-115 Ribosomal protein S4 (.1)
Potri.007G056100 357 / 2e-127 AT5G39850 337 / 1e-119 Ribosomal protein S4 (.1)
Potri.011G094500 353 / 3e-126 AT5G39850 336 / 3e-119 Ribosomal protein S4 (.1)
Potri.006G209801 211 / 6e-71 AT5G15200 200 / 7e-67 Ribosomal protein S4 (.1.2)
Potri.006G209900 143 / 9e-45 AT5G39850 130 / 3e-40 Ribosomal protein S4 (.1)
Potri.017G101200 51 / 5e-08 AT5G15750 291 / 6e-102 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Potri.004G113600 47 / 9e-07 AT5G15750 312 / 3e-110 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008624 355 / 9e-127 AT5G15200 342 / 8e-122 Ribosomal protein S4 (.1.2)
Lus10012839 343 / 5e-122 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2)
Lus10030487 343 / 5e-122 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2)
Lus10042193 336 / 2e-112 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
Lus10001767 48 / 9e-07 AT5G15750 317 / 3e-112 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0492 S4 PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
CL0492 S4 PF01479 S4 S4 domain
Representative CDS sequence
>Potri.016G076500.1 pacid=42810620 polypeptide=Potri.016G076500.1.p locus=Potri.016G076500 ID=Potri.016G076500.1.v4.1 annot-version=v4.1
ATGGTGCATGTGTCCTTCTATCGCAACTACGGGAAAACTTTTAAGAAACCTAGGCGTCCCTATGAGAAGGAACGTTTGGATGCTGAGCTGAAGCTCGTCG
GAGAGTATGGGCTCCGTGCCAAGAGGGAACTCTGGAGGGTCCAGTATGCATTGAGTCGCATTCGTAATGCTGCCAGAATGCTTCTAACCCTTGATGAGAA
GAACTCACGCCGTATCTTTGAGGGTGAGGCGCTTTTGAGGAGGATGAATAGGTATGGGCTTTTGGAGGAGAGTCAGAACAAGCTGGATTACGTGTTGGCT
CTTACGGTGGAAAACTTTCTTGAGCGCCGCCTCCAGACACTTGTTTTCAAGGCTGGTATGGCTAAGTCGATCCACCATGCCCGAGTTCTCATTAAACAGA
AGCACATTAGGGTTGGGAGGCAGGTGGTCAATATTCCATCTTTCATGGTGAGGGTGGACTCGCAGAAGCACATTGATTTCTCTCTCACAAGTCCCTTTGG
TGGTGGACGTCCTGGTAGAGTGAAGCGAAAGAACCAGAAGTCTGCAGCCAAGAAAGCATCTGGTGGAGATGGAGATGAAGAAGATGAAGAATGA
AA sequence
>Potri.016G076500.1 pacid=42810620 polypeptide=Potri.016G076500.1.p locus=Potri.016G076500 ID=Potri.016G076500.1.v4.1 annot-version=v4.1
MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARMLLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLA
LTVENFLERRLQTLVFKAGMAKSIHHARVLIKQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQKSAAKKASGGDGDEEDEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G39850 Ribosomal protein S4 (.1) Potri.016G076500 0 1
AT5G39850 Ribosomal protein S4 (.1) Potri.016G076800 1.00 0.9628
AT5G61030 GR-RBP3 glycine-rich RNA-binding prote... Potri.015G057400 4.00 0.9070
AT3G11710 ATKRS-1 lysyl-tRNA synthetase 1 (.1) Potri.006G166000 6.92 0.9124
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G454101 7.48 0.9323
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G454000 8.60 0.9385
AT1G15250 Zinc-binding ribosomal protein... Potri.006G243300 10.67 0.9196
AT2G09990 Ribosomal protein S5 domain 2-... Potri.001G304700 14.79 0.9365 RPS16.3
AT1G57860 Translation protein SH3-like f... Potri.016G061100 15.32 0.9290
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G453900 21.67 0.9131
AT5G24840 tRNA (guanine-N-7) methyltrans... Potri.006G277100 22.97 0.8329

Potri.016G076500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.