Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52570 181 / 6e-58 alpha/beta-Hydrolases superfamily protein (.1) AT4G10030 53 / 3e-09 alpha/beta-Hydrolases superfamily protein (.1) AT4G10050 40 / 0.0001 esterase/lipase/thioesterase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G076550 [exp] 236 / 9e-81 AT3G52570 327 / 9e-113 alpha/beta-Hydrolases superfamily protein (.1) Potri.016G077066 [exp] 167 / 3e-54 AT3G52570 173 / 1e-53 alpha/beta-Hydrolases superfamily protein (.1) Potri.019G074600 [exp] 54 / 2e-09 AT4G10030 485 / 5e-172 alpha/beta-Hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016992 [exp] 192 / 4e-60 AT3G52570 433 / 1e-150 alpha/beta-Hydrolases superfamily protein (.1) Lus10021315 [exp] 156 / 2e-46 AT3G52570 397 / 2e-136 alpha/beta-Hydrolases superfamily protein (.1) Lus10022689 [exp] 133 / 8e-41 AT3G52570 182 / 5e-57 alpha/beta-Hydrolases superfamily protein (.1) Lus10014222 [exp] 127 / 9e-40 AT3G52570 130 / 1e-38 alpha/beta-Hydrolases superfamily protein (.1) Lus10022691 [exp] 57 / 6e-11 AT3G52570 224 / 5e-73 alpha/beta-Hydrolases superfamily protein (.1) Lus10014220 [exp] 57 / 1e-10 AT3G11510 236 / 4e-78 Ribosomal protein S11 family protein (.1) Lus10041047 [exp] 56 / 6e-10 AT4G10030 513 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [poplar] [flax] AB_hydrolase PF12697 [poplar] [flax] Abhydrolase_6 Alpha/beta hydrolase family
Representative CDS sequence Show only first row Show all	>Potri.016G076601.1 pacid=42809089 polypeptide=Potri.016G076601.1.p locus=Potri.016G076601 ID=Potri.016G076601.1.v4.1 annot-version=v4.1 ATGGTGCTTGTGGATATGAGGAACCATGGCAAATCTGTTGATATAGAGGGATTAGACCCACCTCATAATATGTTTAATGCGGCTATGGATGTGGCTAATT TGGTGAAAGAGAAAGGTTGGGAATGGCCTGATGTTGTTATTGGTCATTCTATGGGAGGCAAAGTTGCTTTGCAATTTGCTGAGAGCTGCACTCGTGGTGA TTATGGTCATTCTGTTTCTTTTCCTAAACAGCTGTGGGTACTGGATTCTGTGCCTGTAGAAGTAAGTCCTGAATATAGTGATGGAGAAGTTGAAAAAGTT TTGAGGACCTTGCATAGTTTACCCTCACCAATCCCATCACGAAGGTAA
AA sequence Show only first row Show all	>Potri.016G076601.1 pacid=42809089 polypeptide=Potri.016G076601.1.p locus=Potri.016G076601 ID=Potri.016G076601.1.v4.1 annot-version=v4.1 MVLVDMRNHGKSVDIEGLDPPHNMFNAAMDVANLVKEKGWEWPDVVIGHSMGGKVALQFAESCTRGDYGHSVSFPKQLWVLDSVPVEVSPEYSDGEVEKV LRTLHSLPSPIPSRR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52570			alpha/beta-Hydrolases superfam...		Potri.016G076601 [exp]	0	1
AT5G65950			unknown protein		Potri.001G457201 [exp]	4.69	0.7285
AT3G02630			Plant stearoyl-acyl-carrier-pr...		Potri.008G077900 [exp]	9.32	0.6952
AT1G17290		ALAAT1	alanine aminotransferas (.1)		Potri.001G162800 [exp]	14.69	0.6311	Pt-ALAAT1.1
AT5G27540		MIRO1, EMB2473	embryo defective 2473, MIRO-re...		Potri.005G033700 [exp]	14.96	0.6310
AT1G26460			Tetratricopeptide repeat (TPR)...		Potri.010G159100 [exp]	15.00	0.6841
AT3G21710			unknown protein		Potri.002G230300 [exp]	17.20	0.6921
AT4G23640		ATKT3, KUP4, TR...	TINY ROOT HAIR 1, Potassium tr...		Potri.003G133900 [exp]	21.90	0.6531
AT2G43770			Transducin/WD40 repeat-like su...		Potri.013G128001 [exp]	22.51	0.6162
AT4G32570	ZIM	TIFY8	TIFY domain protein 8 (.1)		Potri.018G033700 [exp]	24.18	0.6065
AT5G26830			Threonyl-tRNA synthetase (.1)		Potri.008G145600 [exp]	26.32	0.6555	THRRS.1

Compare expression of checked genes

Potri.016G076601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.