Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07930 187 / 1e-59 GTP binding Elongation factor Tu family protein (.1.2) AT5G60390 187 / 8e-59 GTP binding Elongation factor Tu family protein (.1.2.3) AT1G07940 187 / 8e-59 GTP binding Elongation factor Tu family protein (.1.2) AT1G07920 187 / 8e-59 GTP binding Elongation factor Tu family protein (.1) AT1G35550 160 / 2e-52 elongation factor Tu C-terminal domain-containing protein (.1) AT1G18070 55 / 8e-10 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2.3) AT5G10630 40 / 0.0001 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G042500 [exp] 202 / 8e-65 AT5G60390 856 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.008G043100 [exp] 202 / 8e-65 AT5G60390 857 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.008G042700 [exp] 201 / 3e-64 AT5G60390 857 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.010G218600 [exp] 199 / 2e-63 AT5G60390 888 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.006G130900 [exp] 198 / 4e-63 AT5G60390 864 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.010G218700 [exp] 187 / 9e-59 AT5G60390 891 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.010G218800 [exp] 187 / 9e-59 AT5G60390 891 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.010G219500 [exp] 187 / 9e-59 AT5G60390 891 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.010G219000 [exp] 106 / 5e-29 AT2G35790 239 / 3e-79 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015070 [exp] 197 / 9e-64 AT1G07930 684 / 0.0 GTP binding Elongation factor Tu family protein (.1.2) Lus10026488 [exp] 197 / 4e-63 AT1G07920 797 / 0.0 GTP binding Elongation factor Tu family protein (.1) Lus10023174 [exp] 197 / 9e-63 AT1G07940 866 / 0.0 GTP binding Elongation factor Tu family protein (.1.2) Lus10019918 [exp] 197 / 1e-62 AT1G07920 891 / 0.0 GTP binding Elongation factor Tu family protein (.1) Lus10040378 [exp] 191 / 2e-60 AT1G07940 885 / 0.0 GTP binding Elongation factor Tu family protein (.1.2) Lus10023497 [exp] 191 / 2e-60 AT1G07940 885 / 0.0 GTP binding Elongation factor Tu family protein (.1.2) Lus10018000 [exp] 56 / 6e-10 AT1G18070 792 / 0.0 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2.3) Lus10041996 [exp] 56 / 6e-10 AT1G18070 801 / 0.0 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2.3) Lus10020153 [exp] 51 / 2e-08 AT5G10630 774 / 0.0 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2) Lus10026952 [exp] 51 / 2e-08 AT4G31390 878 / 0.0 Protein kinase superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03143 [poplar] [flax] GTP_EFTU_D3 Elongation factor Tu C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.016G086450.1 pacid=42809562 polypeptide=Potri.016G086450.1.p locus=Potri.016G086450 ID=Potri.016G086450.1.v4.1 annot-version=v4.1 ATGAACCACCCAGGTCAGATTGGAAACGGATATGCTCCTGTCCTTGATTGTCACACCTCACACATTGCTGTCAAGTTTTCAGAGATTTTGACCAAGATTG ACAGGCGATCCGGGAAAGAGCTTGAGAAGGAGCCAAAGTTCTTGAAGAATGGTGATGCTGGGTTTGTGAAGATGATTCCCACCAAGCCTATGGTTGTTGA GACCTTTTCTACCTATCCTCCTCTTGGTCGTTTTGCTGTGAGGGACATGCGCCAGACCGTGGCTGTTGGTGTCATCAAGAGTGCTAAGAAGAAAGATGCA TCTGGTGCCAAGGTCACAAAGTCTGCAGTAAAGAAAGGTGGAAAGTGA
AA sequence Show only first row Show all	>Potri.016G086450.1 pacid=42809562 polypeptide=Potri.016G086450.1.p locus=Potri.016G086450 ID=Potri.016G086450.1.v4.1 annot-version=v4.1 MNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSAKKKDA SGAKVTKSAVKKGGK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07930			GTP binding Elongation factor ...		Potri.016G086450 [exp]	0	1
AT5G46940			Plant invertase/pectin methyle...		Potri.005G023201 [exp]	3.87	0.8994
					Potri.006G062150 [exp]	4.89	0.9143
AT5G46940			Plant invertase/pectin methyle...		Potri.005G023100 [exp]	5.19	0.8914
					Potri.015G024900 [exp]	8.00	0.8934
					Potri.003G104800 [exp]	10.09	0.9116
AT1G22970			unknown protein		Potri.010G117100 [exp]	16.09	0.8936
AT5G46940			Plant invertase/pectin methyle...		Potri.005G023050 [exp]	24.49	0.8520
AT3G07440			unknown protein		Potri.007G083100 [exp]	27.71	0.8460
AT2G01350		QPT	quinolinate phoshoribosyltrans...		Potri.010G113500 [exp]	27.92	0.8477
AT1G21280			unknown protein		Potri.004G133001 [exp]	29.66	0.8750

Compare expression of checked genes

Potri.016G086450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.