Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60390 477 / 1e-170 GTP binding Elongation factor Tu family protein (.1.2.3) AT1G07940 478 / 3e-170 GTP binding Elongation factor Tu family protein (.1.2) AT1G07930 478 / 3e-170 GTP binding Elongation factor Tu family protein (.1.2) AT1G07920 478 / 3e-170 GTP binding Elongation factor Tu family protein (.1) AT1G18070 149 / 1e-41 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2.3) AT5G10630 133 / 2e-35 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2) AT4G02930 88 / 1e-19 GTP binding Elongation factor Tu family protein (.1) AT4G20360 83 / 5e-18 AtRab8D, AtRABE1b RAB GTPase homolog E1B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G219500 [exp] 483 / 3e-172 AT5G60390 891 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.010G218800 [exp] 483 / 3e-172 AT5G60390 891 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.010G218700 [exp] 483 / 3e-172 AT5G60390 891 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.006G130900 [exp] 482 / 6e-172 AT5G60390 864 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.008G043100 [exp] 481 / 8e-172 AT5G60390 857 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.008G042700 [exp] 481 / 8e-172 AT5G60390 857 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.008G042500 [exp] 481 / 1e-171 AT5G60390 856 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.010G218600 [exp] 479 / 6e-171 AT5G60390 888 / 0.0 GTP binding Elongation factor Tu family protein (.1.2.3) Potri.019G062500 [exp] 150 / 7e-42 AT1G18070 806 / 0.0 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015070 [exp] 486 / 3e-175 AT1G07930 684 / 0.0 GTP binding Elongation factor Tu family protein (.1.2) Lus10026488 [exp] 485 / 6e-174 AT1G07920 797 / 0.0 GTP binding Elongation factor Tu family protein (.1) Lus10023174 [exp] 486 / 8e-174 AT1G07940 866 / 0.0 GTP binding Elongation factor Tu family protein (.1.2) Lus10019918 [exp] 486 / 1e-173 AT1G07920 891 / 0.0 GTP binding Elongation factor Tu family protein (.1) Lus10040378 [exp] 486 / 2e-173 AT1G07940 885 / 0.0 GTP binding Elongation factor Tu family protein (.1.2) Lus10023497 [exp] 486 / 2e-173 AT1G07940 885 / 0.0 GTP binding Elongation factor Tu family protein (.1.2) Lus10041996 [exp] 144 / 2e-39 AT1G18070 801 / 0.0 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2.3) Lus10018000 [exp] 144 / 3e-39 AT1G18070 792 / 0.0 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2.3) Lus10020153 [exp] 144 / 4e-39 AT5G10630 774 / 0.0 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2) Lus10026952 [exp] 144 / 9e-39 AT4G31390 878 / 0.0 Protein kinase superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00009 [poplar] [flax] GTP_EFTU Elongation factor Tu GTP binding domain CL0575 [poplar] [flax] EFTPs PF03144 [poplar] [flax] GTP_EFTU_D2 Elongation factor Tu domain 2
Representative CDS sequence Show only first row Show all	>Potri.016G086500.4 pacid=42809960 polypeptide=Potri.016G086500.4.p locus=Potri.016G086500 ID=Potri.016G086500.4.v4.1 annot-version=v4.1 ATGATCACTGGTACCTCACAGGCTGACTGTGCTGTCCTCATTATTGATTCCACCACTGGTGGTTTTGAAGCTGGTATCTCCAAGGATGGCCAGACCCGTG AGCATGCCCTACTTGCTTTTACCCTTGGTGTCAAGCAGATGATTTGCTGTTGCACCAAGATGGATGCTACCACCCCCAAGTACTCCAAGGCCAGGTACGA AGAAATCGTGAAGGAAGTTTCCTCTTACTTGAAGAAGGTTGGTTACAACCCTGAGAAGATCCCCTTTGTCCCTATCTCTGGTTTTGAGGGCGATAACATG ATTGAGAGGTCTACCAACCTTGACTGGTACAAGGGCCCTACCCTCCTTGAATCTCTTGACCAGATCAATGAGCCCAAGAGACCATCAGACAAGCCCCTCC GTCTTCTACTTCAGGATGTCTACAAGATTGGAGGTATTGGAACTGTACCTGTTGGACGAGTTGCGACTGGTATCCTGAAGCCTGGAATGGTTGTGACCTT TGGCCCCTCTGGGCTGACCACTGAAGTTAAATCTGTTGAGATGCACCATGAAGCTCTCCAGGAGGCCCTTCCAGGTGACAATGTTGGTTTCAATGTTAAA AATGTTGCTGTCAAGGATCTCAAGCGTGGTTTTGTTGCTTCTAACTCTAAGGATGCTCCTGCCAGGGAGGCTGCTAACTTCACCTCTCAGGTCATCATCA TGAACCACCCAGGTCAGATTGGAAACGGATATGCTGCCTGGAATGGTTGTGACCTTTGGCCCCTCTGGGCTGACCACTGA
AA sequence Show only first row Show all	>Potri.016G086500.4 pacid=42809960 polypeptide=Potri.016G086500.4.p locus=Potri.016G086500 ID=Potri.016G086500.4.v4.1 annot-version=v4.1 MITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCTKMDATTPKYSKARYEEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNM IERSTNLDWYKGPTLLESLDQINEPKRPSDKPLRLLLQDVYKIGGIGTVPVGRVATGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVK NVAVKDLKRGFVASNSKDAPAREAANFTSQVIIMNHPGQIGNGYAAWNGCDLWPLWADH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G60390			GTP binding Elongation factor ...		Potri.016G086500 [exp]	0	1
AT5G65950			unknown protein		Potri.001G457201 [exp]	6.92	0.7452
AT5G24810			ABC1 family protein (.1.2)		Potri.012G082950 [exp]	9.32	0.7936
AT4G35830		ACO1	aconitase 1 (.1.2)		Potri.015G130201 [exp]	19.87	0.7718
AT4G28700		AMT1;4	ammonium transporter 1;4 (.1)		Potri.002G255100 [exp]	34.05	0.6457	4
AT2G06255		ELF4-L3	ELF4-like 3 (.1)		Potri.019G131700 [exp]	36.87	0.7238
AT1G56070		LOS1, AT1G56075...	LOW EXPRESSION OF OSMOTICALLY ...		Potri.002G177032 [exp]	53.91	0.7101
AT3G42170			BED zinc finger ;hAT family di...		Potri.018G126500 [exp]	55.11	0.7197
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	60.39	0.6902
AT5G52552		CPuORF14	conserved peptide upstream ope...		Potri.017G143300 [exp]	69.32	0.6555
AT4G30850		HHP2	heptahelical transmembrane pr...		Potri.018G102400 [exp]	70.14	0.6926

Compare expression of checked genes

Potri.016G086500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.