SYP71.2 (Potri.016G088200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol SYP71.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09740 384 / 3e-136 ATSYP71, SYP71 syntaxin of plants 71 (.1)
AT3G61450 318 / 4e-110 ATSYP73, SYP73 syntaxin of plants 73 (.1.2)
AT3G45280 306 / 3e-105 ATSYP72, SYP72 syntaxin of plants 72 (.1)
AT5G61210 45 / 2e-05 SNP33, ATSNAP33B, SNAP33 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
AT1G13890 44 / 6e-05 ATSNAP30, SNAP30 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G129500 456 / 1e-164 AT3G09740 377 / 3e-133 syntaxin of plants 71 (.1)
Potri.014G087400 355 / 2e-124 AT3G09740 352 / 2e-123 syntaxin of plants 71 (.1)
Potri.012G066700 47 / 5e-06 AT5G61210 360 / 3e-125 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
Potri.015G049000 45 / 2e-05 AT5G61210 403 / 3e-142 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
Potri.010G160350 42 / 0.0003 AT1G13890 266 / 2e-89 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019925 418 / 3e-149 AT3G09740 419 / 2e-149 syntaxin of plants 71 (.1)
Lus10026495 408 / 5e-145 AT3G09740 408 / 5e-145 syntaxin of plants 71 (.1)
Lus10023178 404 / 5e-144 AT3G09740 416 / 1e-148 syntaxin of plants 71 (.1)
Lus10015075 397 / 5e-141 AT3G09740 417 / 3e-149 syntaxin of plants 71 (.1)
Lus10036118 323 / 2e-111 AT3G45280 363 / 3e-127 syntaxin of plants 72 (.1)
Lus10036377 319 / 3e-106 AT3G09740 347 / 8e-117 syntaxin of plants 71 (.1)
Lus10014759 285 / 1e-92 AT3G09740 308 / 4e-102 syntaxin of plants 71 (.1)
Lus10026653 50 / 4e-07 AT1G13890 220 / 1e-72 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Lus10004660 50 / 7e-07 AT1G13890 349 / 4e-122 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Lus10037092 49 / 1e-06 AT1G13890 327 / 1e-113 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05739 SNARE SNARE domain
Representative CDS sequence
>Potri.016G088200.1 pacid=42810692 polypeptide=Potri.016G088200.1.p locus=Potri.016G088200 ID=Potri.016G088200.1.v4.1 annot-version=v4.1
ATGAGCGTGATTGACATATTAACTCGAGTAGACGCGATCTGCAACAAATACGACAAATACGACATTGAAAAGCAAAAAGATCTCAATGTCTCCGGCGACG
ATGCCTTTGCTCGCCTCTACGCCGCCATTGATTCTGACATTGAAGCGGCTCACCAGAAAGCCGAGCTTGCTTCCAAGGAGAAAAGTAAGGCCTCTGCTGT
TGCTATAAACGCAGAGCTTCGTAGAACTAAGGCTAGATTGCTTGAGGAAGTCCCTAAACTGCAGAGATTAGCCGTAAAGAAGGTTAAAGGACTTTCTACA
GAAGAACTTGCTGCACGAAATGATTTGGTCCTTGCATTGCCAGATAGGATTCAAGCTATACCAGATGGAACTGCAGCTGCGCCCAAACAAACTGGAGGTT
GGGGGACTTCAGCTCCCCGTGCTGAAATCAAATTTGATTCAGATGGGCAGTTTGATAATGAATACTTTCAAGAAACTGAGACGTCTAGTCAATTCAGGCA
AGAGTATGAAATGCGTAAAATGAAGCAGGATCAAGGGTTGGATATGATTTCAGATGGTTTGGACACGCTGAAGAATATGGCTCATGACATGAATGAGGAG
ATTGACAGACAAGTTCCTTTGATGGATGAAATTGACACTAAGGTGGACAAGGCGGCTGCTGACCTTAAGAATACCAATGTTAGACTTAAAGACACTGTTA
ACCAGTTGAGATCTAGTCGGAATTTCTGTATTGATATTGTTTTGTTGATCATAATCCTTGGAATAGCTGCCTACTTGTACAATGTGCTGAAGAAGTGA
AA sequence
>Potri.016G088200.1 pacid=42810692 polypeptide=Potri.016G088200.1.p locus=Potri.016G088200 ID=Potri.016G088200.1.v4.1 annot-version=v4.1
MSVIDILTRVDAICNKYDKYDIEKQKDLNVSGDDAFARLYAAIDSDIEAAHQKAELASKEKSKASAVAINAELRRTKARLLEEVPKLQRLAVKKVKGLST
EELAARNDLVLALPDRIQAIPDGTAAAPKQTGGWGTSAPRAEIKFDSDGQFDNEYFQETETSSQFRQEYEMRKMKQDQGLDMISDGLDTLKNMAHDMNEE
IDRQVPLMDEIDTKVDKAAADLKNTNVRLKDTVNQLRSSRNFCIDIVLLIIILGIAAYLYNVLKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Potri.016G088200 0 1 SYP71.2
AT5G19050 alpha/beta-Hydrolases superfam... Potri.008G202300 1.41 0.9616
AT2G17990 unknown protein Potri.005G115500 1.73 0.9523
AT1G11890 ATSEC22, SEC22 SECRETION 22, Synaptobrevin fa... Potri.001G165600 2.82 0.9383 Pt-SEC22.1
AT1G60970 SNARE-like superfamily protein... Potri.003G043200 2.82 0.9604
AT4G02620 vacuolar ATPase subunit F fami... Potri.005G217600 3.00 0.9378 VATF.1
AT4G29340 PRF4 profilin 4 (.1) Potri.006G235200 3.87 0.9493 Pt-PRO1.4
AT4G35410 Clathrin adaptor complex small... Potri.014G079000 5.29 0.9500 AP19.1
AT2G40620 bZIP AtbZIP18 Basic-leucine zipper (bZIP) tr... Potri.013G156900 6.48 0.9121
AT1G02130 ARA5, AtRABD2a,... ARABIDOPSIS THALIANA RAB D2A, ... Potri.014G049400 8.06 0.9324 RAB1.2
AT1G32210 ATDAD1 DEFENDER AGAINST APOPTOTIC DEA... Potri.003G096800 8.30 0.9283 Pt-DAD1.1

Potri.016G088200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.