Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03190 47 / 2e-09 CPuORF47 conserved peptide upstream open reading frame 47 (.1.2.3) AT3G53402 46 / 3e-09 CPuORF46 conserved peptide upstream open reading frame 46 (.1) AT1G58122 33 / 0.0007 CPuORF45 conserved peptide upstream open reading frame 45 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G104450 [exp] 36 / 5e-05 AT1G58122 63 / 4e-16 conserved peptide upstream open reading frame 45 (.1) Potri.007G113150 [exp] 36 / 5e-05 AT1G58122 56 / 3e-13 conserved peptide upstream open reading frame 45 (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G088850.1 pacid=42809231 polypeptide=Potri.016G088850.1.p locus=Potri.016G088850 ID=Potri.016G088850.1.v4.1 annot-version=v4.1 ATGGTTTTTATTTCCAATCAAGTAAAGATGGTATTTGAGGCAAAGCCAAGAGTTCATAAAAGGGTCTGGTTAATGTTTCAAAAATCAATGGGTGTCCTTG TGGGTGGGAATCATACCTCCTCCAGGTTTTGTACTCGTTAA
AA sequence Show only first row Show all	>Potri.016G088850.1 pacid=42809231 polypeptide=Potri.016G088850.1.p locus=Potri.016G088850 ID=Potri.016G088850.1.v4.1 annot-version=v4.1 MVFISNQVKMVFEAKPRVHKRVWLMFQKSMGVLVGGNHTSSRFCTR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G03190		CPuORF47	conserved peptide upstream ope...		Potri.016G088850 [exp]	0	1
AT1G56070		LOS1, AT1G56075...	LOW EXPRESSION OF OSMOTICALLY ...		Potri.002G177032 [exp]	5.19	0.7941
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.006G090033 [exp]	8.30	0.7733
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.001G216800 [exp]	12.44	0.7625
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	17.34	0.7517
AT1G29951		CPuORF35	conserved peptide upstream ope...		Potri.011G080100 [exp]	17.54	0.7174
AT1G72890			Disease resistance protein (TI...		Potri.011G013225 [exp]	20.00	0.7336
AT5G07900			Mitochondrial transcription te...		Potri.004G012300 [exp]	24.97	0.7237
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.007G113150 [exp]	27.12	0.7380
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044050 [exp]	39.98	0.7184
					Potri.010G080633 [exp]	47.00	0.7150

Compare expression of checked genes

Potri.016G088850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.