Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03230 115 / 6e-33 Protein of unknown function, DUF584 (.1) AT5G60680 98 / 2e-26 Protein of unknown function, DUF584 (.1) AT3G45210 94 / 7e-25 Protein of unknown function, DUF584 (.1) AT2G28400 93 / 2e-24 Protein of unknown function, DUF584 (.1) AT4G04630 81 / 1e-19 Protein of unknown function, DUF584 (.1) AT1G61930 77 / 1e-17 Protein of unknown function, DUF584 (.1) AT1G11700 76 / 1e-17 Protein of unknown function, DUF584 (.1) AT4G21970 73 / 1e-16 Protein of unknown function, DUF584 (.1) AT4G21930 64 / 4e-13 Protein of unknown function, DUF584 (.1) AT3G15040 64 / 1e-12 Protein of unknown function, DUF584 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G127900 [exp] 213 / 1e-71 AT5G03230 122 / 1e-35 Protein of unknown function, DUF584 (.1) Potri.009G014100 [exp] 112 / 7e-32 AT3G45210 124 / 2e-36 Protein of unknown function, DUF584 (.1) Potri.004G211100 [exp] 107 / 1e-29 AT5G60680 120 / 1e-34 Protein of unknown function, DUF584 (.1) Potri.011G003300 [exp] 79 / 2e-18 AT1G11700 161 / 6e-50 Protein of unknown function, DUF584 (.1) Potri.011G004100 [exp] 77 / 8e-18 AT4G04630 125 / 1e-36 Protein of unknown function, DUF584 (.1) Potri.004G014000 [exp] 74 / 1e-16 AT4G04630 124 / 4e-36 Protein of unknown function, DUF584 (.1) Potri.004G015700 [exp] 74 / 2e-16 AT1G11700 151 / 5e-46 Protein of unknown function, DUF584 (.1) Potri.016G076300 [exp] 67 / 7e-14 AT3G15040 90 / 9e-22 Protein of unknown function, DUF584 (.1) Potri.011G076900 [exp] 48 / 2e-07 AT1G29640 90 / 4e-24 Protein of unknown function, DUF584 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019936 [exp] 120 / 1e-34 AT5G03230 99 / 1e-26 Protein of unknown function, DUF584 (.1) Lus10026507 [exp] 117 / 3e-32 AT5G03230 97 / 1e-24 Protein of unknown function, DUF584 (.1) Lus10041309 [exp] 108 / 3e-30 AT5G60680 137 / 5e-42 Protein of unknown function, DUF584 (.1) Lus10021474 [exp] 103 / 3e-28 AT5G60680 138 / 6e-42 Protein of unknown function, DUF584 (.1) Lus10015087 [exp] 92 / 4e-24 AT5G03230 87 / 6e-22 Protein of unknown function, DUF584 (.1) Lus10000724 [exp] 86 / 2e-21 AT3G45210 111 / 1e-31 Protein of unknown function, DUF584 (.1) Lus10006775 [exp] 74 / 1e-17 AT1G61930 110 / 4e-32 Protein of unknown function, DUF584 (.1) Lus10020043 [exp] 74 / 9e-17 AT4G21970 127 / 1e-37 Protein of unknown function, DUF584 (.1) Lus10020047 [exp] 74 / 9e-17 AT1G61930 124 / 8e-36 Protein of unknown function, DUF584 (.1) Lus10006781 [exp] 72 / 4e-16 AT4G21970 128 / 6e-38 Protein of unknown function, DUF584 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04520 [poplar] [flax] Senescence_reg Senescence regulator
Representative CDS sequence Show only first row Show all	>Potri.016G089900.2 pacid=42808966 polypeptide=Potri.016G089900.2.p locus=Potri.016G089900 ID=Potri.016G089900.2.v4.1 annot-version=v4.1 ATGGCATCAAAGAAGTTTTTCAACGCAAGAGCTAACTACATCTACCCTACTCTGGGGAGTGGTAATAATACAATCACTGCTCATGACAAAGTTTTTGAGT TGGATGAGGATGATGTTTATAATTCCAGCGTTGTTTCATCGTTGGAGAGCAGGAAAACGATACCAAGTTCTCGTTCATCAAAGAAAGCTCCAAGGAAGGT CGAAATGGCCAAGGACCTGGCCCCGGTGACATGTGCATCGTTGCCCGTGAACATACCGGATTGGTCCAAGATTTATAGCGATCATCAAAGGAAAGAGAAT GAAAATAGTATTTATCAGCTTGATGATGATTCTGACCATGATGATGATGATGATCTAGATGGTAGAGTGCCTCCACATGAATATTTAGCTAGGAGGAGAG GAGCCTCCTTTTCTGTTCATGAAGGGATCGGAAGGACCTTGAAAGGGAGGGACTTGCGCCAGGTGAGAAATGCAGTTTGGGAGAGAGTTGGATTTGAAGA TTAG
AA sequence Show only first row Show all	>Potri.016G089900.2 pacid=42808966 polypeptide=Potri.016G089900.2.p locus=Potri.016G089900 ID=Potri.016G089900.2.v4.1 annot-version=v4.1 MASKKFFNARANYIYPTLGSGNNTITAHDKVFELDEDDVYNSSVVSSLESRKTIPSSRSSKKAPRKVEMAKDLAPVTCASLPVNIPDWSKIYSDHQRKEN ENSIYQLDDDSDHDDDDDLDGRVPPHEYLARRRGASFSVHEGIGRTLKGRDLRQVRNAVWERVGFED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G03230			Protein of unknown function, D...		Potri.016G089900 [exp]	0	1
AT4G10265			Wound-responsive family protei...		Potri.011G126000 [exp]	8.60	0.7441
AT2G44310			Calcium-binding EF-hand family...		Potri.002G218500 [exp]	11.66	0.7440
AT3G05550			Hypoxia-responsive family prot...		Potri.019G056000 [exp]	15.09	0.7336
					Potri.009G109200 [exp]	16.97	0.7322
AT4G10270			Wound-responsive family protei...		Potri.019G117632 [exp]	17.32	0.7300
					Potri.011G126100 [exp]	23.10	0.7191
AT5G66985			unknown protein		Potri.005G131000 [exp]	24.97	0.7124
AT2G44310			Calcium-binding EF-hand family...		Potri.002G218300 [exp]	25.23	0.7166
AT4G10270			Wound-responsive family protei...		Potri.019G117301 [exp]	27.92	0.6985
AT5G25940			early nodulin-related (.1)		Potri.009G143800 [exp]	28.61	0.7118

Compare expression of checked genes

Potri.016G089900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.