Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37210 392 / 1e-140 LOG3 LONELY GUY 3, lysine decarboxylase family protein (.1.2) AT3G53450 379 / 2e-135 LOG4 LONELY GUY 4, Putative lysine decarboxylase family protein (.1) AT2G28305 377 / 1e-134 ATLOG1 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) AT5G06300 341 / 1e-120 LOG7 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) AT4G35190 311 / 1e-108 LOG5 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) AT2G35990 309 / 6e-108 LOG2 LONELY GUY 2, Putative lysine decarboxylase family protein (.1.2.3) AT5G11950 301 / 8e-105 LOG8 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) AT5G03270 273 / 2e-93 LOG6 LONELY GUY 6, lysine decarboxylase family protein (.1) AT5G26140 170 / 5e-54 ATLOG9 LONELY GUY 9, Putative lysine decarboxylase family protein (.1) AT1G50575 44 / 3e-05 Putative lysine decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G127400 [exp] 440 / 2e-159 AT2G37210 396 / 3e-142 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.009G010800 [exp] 381 / 2e-136 AT2G28305 359 / 8e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.004G212200 [exp] 381 / 2e-136 AT2G28305 361 / 1e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.005G237600 [exp] 347 / 1e-122 AT5G06300 338 / 2e-119 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.002G024000 [exp] 345 / 5e-122 AT2G37210 310 / 2e-108 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.002G012500 [exp] 338 / 3e-119 AT4G35190 300 / 5e-104 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.006G204800 [exp] 333 / 3e-117 AT5G06300 316 / 9e-111 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.005G248900 [exp] 333 / 4e-117 AT4G35190 297 / 7e-103 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.004G181800 [exp] 326 / 2e-114 AT4G35190 361 / 3e-128 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026513 [exp] 411 / 4e-148 AT2G37210 394 / 1e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10002226 [exp] 396 / 3e-142 AT2G37210 379 / 2e-135 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10016096 [exp] 381 / 4e-136 AT2G28305 384 / 7e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10023190 [exp] 380 / 5e-136 AT2G37210 364 / 6e-130 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10021462 [exp] 380 / 6e-136 AT2G28305 386 / 1e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10012436 [exp] 338 / 3e-119 AT5G06300 332 / 7e-117 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10024328 [exp] 332 / 1e-116 AT5G06300 328 / 2e-115 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10025117 [exp] 331 / 6e-116 AT4G35190 373 / 1e-132 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10003335 [exp] 326 / 4e-114 AT4G35190 359 / 2e-127 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10022638 [exp] 324 / 2e-113 AT4G35190 365 / 2e-129 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0349 [poplar] [flax] SLOG PF03641 [poplar] [flax] Lysine_decarbox Possible lysine decarboxylase
Representative CDS sequence Show only first row Show all	>Potri.016G090500.1 pacid=42808962 polypeptide=Potri.016G090500.1.p locus=Potri.016G090500 ID=Potri.016G090500.1.v4.1 annot-version=v4.1 ATGGAGATCATAGAGACAACTACTCTGCAGCAGCAATCAATGTCGTCTAAGTTCAAGAGGATTTGTGTTTTTTGTGGGAGTAGTCAAGGCAAGAAGACTA GCTATCAAGTTGCTGCTATTGACCTTGGCAACGAATTGGTCTCAAGGAATATTGATCTGGTCTATGGAGGAGGTAGCATAGGTTTGATGGGTTTGGTTTC ACAAGCTGTTCATGATGGTGGTCGTCATGTTATTGGAGTTATTCCCAAGACGCTCATGCCTCGAGAGCTGACTGGTGAAACAGTAGGAGAAGTGAAGGCA GTTGCAGATATGCATCAAAGGAAGGCAGAGATGGCTAAGCATTCTGATGCTTTTATTGCCTTACCAGGTGGTTATGGAACGCTGGAAGAGTTACTTGAAG TCATAACCTGGGCTCAACTCGGAATTCATGACAAACCGGTTGGATTGCTTAATGTTGATGGATACTACAATTCCTTACTCTCGTTTATTGACAAAGCTGT GGAAGAGGGATTTATTAATCCCAGTGCACGCAACATTATCGTTTCTGCACCAACAGCAAAAGAGCTGGTGAAGAAACTGGAGGAGTACGTCCCCTGTCAT GAAAGAGTTGCGTCAAAGTTGAGCTGGGAAATTGAGCAACTTGGCTGCTCTCAAAATCATGATATCTCTAGGTGA
AA sequence Show only first row Show all	>Potri.016G090500.1 pacid=42808962 polypeptide=Potri.016G090500.1.p locus=Potri.016G090500 ID=Potri.016G090500.1.v4.1 annot-version=v4.1 MEIIETTTLQQQSMSSKFKRICVFCGSSQGKKTSYQVAAIDLGNELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKA VADMHQRKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFINPSARNIIVSAPTAKELVKKLEEYVPCH ERVASKLSWEIEQLGCSQNHDISR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Potri.016G090500 [exp]	0	1
AT5G58560		FOLK	farnesol kinase, Phosphatidate...		Potri.009G074800 [exp]	6.16	0.8232
AT4G31590		ATCSLC5, ATCSLC...	CELLULOSE-SYNTHASE LIKE C5, Ce...		Potri.018G009300 [exp]	7.61	0.8854
AT5G25310			Exostosin family protein (.1)		Potri.018G025400 [exp]	9.38	0.7839
AT5G11420			Protein of unknown function, D...		Potri.018G031100 [exp]	20.09	0.8577
AT5G47500		PME5	pectin methylesterase 5, Pecti...		Potri.003G076900 [exp]	20.78	0.8558
AT2G23910			NAD(P)-binding Rossmann-fold s...		Potri.013G079500 [exp]	29.05	0.8500
AT3G52870			IQ calmodulin-binding motif fa...		Potri.016G034100 [exp]	33.31	0.8126
AT5G58560		FOLK	farnesol kinase, Phosphatidate...		Potri.009G074700 [exp]	38.79	0.7416
AT5G18080		SAUR24	small auxin up RNA 24, SAUR-li...		Potri.004G165400 [exp]	41.85	0.8410
AT3G26380			Melibiase family protein (.1)		Potri.010G048400 [exp]	59.37	0.7363

Compare expression of checked genes

Potri.016G090500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.