Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09870 109 / 5e-32 SAUR-like auxin-responsive protein family (.1) AT2G28085 81 / 8e-21 SAUR-like auxin-responsive protein family (.1) AT4G34760 65 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT2G21220 64 / 3e-14 SAUR-like auxin-responsive protein family (.1) AT4G38860 64 / 4e-14 SAUR-like auxin-responsive protein family (.1) AT2G46690 64 / 5e-14 SAUR-like auxin-responsive protein family (.1) AT3G43120 64 / 8e-14 SAUR-like auxin-responsive protein family (.1) AT2G37030 62 / 3e-13 SAUR-like auxin-responsive protein family (.1) AT1G19840 62 / 6e-13 SAUR-like auxin-responsive protein family (.1) AT3G12830 61 / 1e-12 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G125100 [exp] 220 / 8e-76 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G226400 [exp] 86 / 2e-22 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 68 / 9e-16 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 67 / 2e-15 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 67 / 3e-15 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 67 / 5e-15 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 67 / 6e-15 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 62 / 1e-13 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 62 / 2e-13 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004014 [exp] 149 / 1e-47 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1) Lus10030263 [exp] 146 / 3e-46 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1) Lus10013819 [exp] 131 / 2e-40 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1) Lus10026531 [exp] 131 / 3e-40 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1) Lus10001398 [exp] 115 / 7e-34 AT3G09870 97 / 9e-27 SAUR-like auxin-responsive protein family (.1) Lus10023012 [exp] 113 / 3e-33 AT3G09870 97 / 5e-27 SAUR-like auxin-responsive protein family (.1) Lus10016129 [exp] 100 / 3e-28 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1) Lus10021435 [exp] 100 / 3e-28 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1) Lus10021436 [exp] 100 / 8e-28 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1) Lus10001397 [exp] 98 / 3e-27 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.016G092400.1 pacid=42809462 polypeptide=Potri.016G092400.1.p locus=Potri.016G092400 ID=Potri.016G092400.1.v4.1 annot-version=v4.1 ATGGAAGAAAGCCTTACAAGAGCAATGATGCTTAAGCTTTTCATAAGAAAGTTGAAGCGGGTTCTCTTGCTCTCAGCTTCTAGAGGAGCCAATACGAGTG AAGTCAGGTTTGATGAAGTGATGGAAGCTACAAAAATGGTTCCAGGAGATGTGAAGAAGGGACATTTTGCAGTCACTGCAACCAAGGGTGAAGAACCGAA GAGGTTTATTGTGGAGCTGAATTACCTCACTAATCCAGATTTCTTGAGCTTACTGGAGCAGGCTAAAGAGGAATACGGATTTCAACAGGAGGGAGTTCTT GCAGTTCCATGTCGACCAGAAGAATTACAGAAGATTTTAGAAAACAGGAGAAAGAGAAGGGCAAGCACTGAATGGTAG
AA sequence Show only first row Show all	>Potri.016G092400.1 pacid=42809462 polypeptide=Potri.016G092400.1.p locus=Potri.016G092400 ID=Potri.016G092400.1.v4.1 annot-version=v4.1 MEESLTRAMMLKLFIRKLKRVLLLSASRGANTSEVRFDEVMEATKMVPGDVKKGHFAVTATKGEEPKRFIVELNYLTNPDFLSLLEQAKEEYGFQQEGVL AVPCRPEELQKILENRRKRRASTEW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09870			SAUR-like auxin-responsive pro...		Potri.016G092400 [exp]	0	1
AT5G05580		AtFAD8, SH1, FA...	fatty acid desaturase 8 (.1.2)		Potri.006G101500 [exp]	5.83	0.9277	FAD3.2
AT5G19855		AtRbcX2	homologue of cyanobacterial Rb...		Potri.009G053300 [exp]	6.24	0.9288
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.011G021332 [exp]	11.48	0.9163
AT5G23530		ATCXE18	carboxyesterase 18 (.1)		Potri.019G014306 [exp]	12.96	0.9092
AT3G56140			Protein of unknown function (D...		Potri.008G074300 [exp]	15.09	0.9068
AT1G75460			ATP-dependent protease La (LON...		Potri.005G232800 [exp]	20.66	0.9030
AT2G04039			unknown protein		Potri.014G172800 [exp]	26.26	0.9090
AT2G05620		PGR5	proton gradient regulation 5 (...		Potri.008G171000 [exp]	26.53	0.9027	PGR5.2
AT3G56010			unknown protein		Potri.008G070700 [exp]	34.62	0.8973
AT4G24930			thylakoid lumenal 17.9 kDa pro...		Potri.015G097700 [exp]	41.46	0.8994

Compare expression of checked genes

Potri.016G092400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.