Potri.016G094700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03330 316 / 7e-107 Cysteine proteinases superfamily protein (.1.2)
AT5G04250 277 / 2e-91 Cysteine proteinases superfamily protein (.1.2)
AT3G02070 239 / 1e-78 Cysteine proteinases superfamily protein (.1)
AT3G22260 213 / 4e-68 Cysteine proteinases superfamily protein (.1.2.3)
AT2G39320 98 / 3e-24 Cysteine proteinases superfamily protein (.1)
AT5G67170 61 / 5e-10 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 49 / 3e-06 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G125900 575 / 0 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.010G225400 302 / 4e-101 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036700 289 / 8e-96 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.016G019700 238 / 6e-78 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G021700 235 / 8e-77 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 235 / 9e-77 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.008G036900 223 / 1e-72 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.005G140500 64 / 4e-11 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.004G196800 47 / 1e-05 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001404 390 / 6e-136 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 382 / 7e-133 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 342 / 5e-117 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10013813 338 / 2e-115 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10038708 286 / 1e-94 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 282 / 4e-93 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 273 / 2e-90 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Lus10010459 223 / 5e-72 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027312 211 / 2e-66 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10003816 190 / 4e-59 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.016G094700.4 pacid=42809721 polypeptide=Potri.016G094700.4.p locus=Potri.016G094700 ID=Potri.016G094700.4.v4.1 annot-version=v4.1
ATGGTTATTTACGAGCAAGATTCGGATGTTATTCAATGGGGTCTTCGTCTTCTTGATGGAGACCCACCCTATTATTCTGGGTACTATGGTGATGCCATCA
TACAGAGTGATGATGGATATCATGGACATTATGTGCGGGATCATTATGATATTTCGGATTGCAGCCATGTAGAGAGCGATGAGATGATTGCGCGCACCTT
GCAAGAAGAGTTTTCGCAGCTTGCCGTTACTGAAGCTACTGAATATTCACATGGTGGAGAAGAACATTTACACACTTCCGTTGATGAGCATCCTTGGCAA
TGTACACCCACTAGGAACTACTGTTCAGACAATGAATGTAGTCATGAAGAATCAGATGATGCAGTACCCTCTAGTTCATGCTCAAGTCCTGCTAATGGAG
AAGAGTATTCCTACTCACCAGAATCTAATGATGATTATGAGCTGGATGATGAAGTAGGCAAGAGGTTGAATCAGTTGATCCCAATCCGTCATGTTCCTAG
AATTAATGGAGAAATACCGTCAATTGATGAAGCAACCTCGGATCATGAAAGGCTTCTGAACAGACTGCAGTTATTTGGCTTTGATGAACTTAAGGTTCAA
GGAGATGGAAACTGTCAGTTCCGTGCTTTATCCGATCAAATATATAATACACCTGATCGCCACAAAACTGTAAGACGACAGGTTGTGTATCAGCTTAATT
CTCACCCAGAGATATATGAGGGATATGTTCCCATGGAGTATGGTGAATATTTGAGGAAAATGTCAAGGAGTGGTGAGTGGGGTGATCATGTGACATTGCA
AGCAGCCGCGGATTCGTATGGTGTGAAAATACTCGTTATGACTTCTTTCAAGGACACATGTTACATAGAGATTCTTCCTGTCAGCCAAAAGCCAAAAGGA
GTCATTTTCTTGAGCTTTTGGGCTGAGGTACATTACAACTCCATCTATTTTCAAGGAGATACATCTAGTGAATTCAGAAAGAAGAAGAGGTGGTGGAGTT
TCGGGAATAAGCACTAG
AA sequence
>Potri.016G094700.4 pacid=42809721 polypeptide=Potri.016G094700.4.p locus=Potri.016G094700 ID=Potri.016G094700.4.v4.1 annot-version=v4.1
MVIYEQDSDVIQWGLRLLDGDPPYYSGYYGDAIIQSDDGYHGHYVRDHYDISDCSHVESDEMIARTLQEEFSQLAVTEATEYSHGGEEHLHTSVDEHPWQ
CTPTRNYCSDNECSHEESDDAVPSSSCSSPANGEEYSYSPESNDDYELDDEVGKRLNQLIPIRHVPRINGEIPSIDEATSDHERLLNRLQLFGFDELKVQ
GDGNCQFRALSDQIYNTPDRHKTVRRQVVYQLNSHPEIYEGYVPMEYGEYLRKMSRSGEWGDHVTLQAAADSYGVKILVMTSFKDTCYIEILPVSQKPKG
VIFLSFWAEVHYNSIYFQGDTSSEFRKKKRWWSFGNKH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G03330 Cysteine proteinases superfami... Potri.016G094700 0 1
AT3G54190 Transducin/WD40 repeat-like su... Potri.006G113000 1.41 0.8492
AT5G40740 unknown protein Potri.001G337600 6.92 0.7957
AT3G05480 ATRAD9 cell cycle checkpoint control ... Potri.013G017500 12.00 0.8260
AT5G40270 HD domain-containing metal-dep... Potri.009G147800 12.72 0.8569
AT5G43670 Sec23/Sec24 protein transport ... Potri.008G161300 18.00 0.8424
AT5G27830 unknown protein Potri.005G024200 18.70 0.8386
AT5G05310 TLC ATP/ADP transporter (.1.2.... Potri.019G048700 22.62 0.7884
AT1G61900 unknown protein Potri.004G016000 24.24 0.8220
AT3G52120 SWAP (Suppressor-of-White-APri... Potri.009G064600 32.21 0.8373
AT5G20930 TSL TOUSLED, Protein kinase superf... Potri.004G193300 35.24 0.8309

Potri.016G094700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.