Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37000 105 / 2e-28 TCP TCP11 TCP family transcription factor (.1) AT3G27010 100 / 1e-25 TCP ATTCP20, PCF1, AT-TCP20 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) AT1G69690 100 / 2e-25 TCP AtTCP15, TCP15 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) AT1G72010 100 / 7e-25 TCP TCP22 TCP family transcription factor (.1) AT5G08330 97 / 9e-25 TCP AtTCP11, CHE, TCP21 TCP domain protein 11, TCP family transcription factor (.1) AT3G47620 100 / 1e-24 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) AT2G45680 99 / 1e-24 TCP TCP9 TCP family transcription factor (.1) AT1G58100 99 / 2e-24 TCP TCP8 TCP domain protein 8, TCP family transcription factor (.1.2) AT5G23280 96 / 3e-24 TCP TCP7 TCP family transcription factor (.1) AT5G41030 94 / 1e-23 TCP TCP6 TCP family transcription factor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G125800 [exp] 197 / 2e-64 AT2G37000 105 / 1e-28 TCP family transcription factor (.1) Potri.017G068748 [exp] 103 / 2e-26 AT3G27010 231 / 3e-74 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.001G327100 [exp] 102 / 3e-26 AT3G27010 230 / 6e-74 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.014G078500 [exp] 102 / 4e-26 AT2G45680 257 / 1e-83 TCP family transcription factor (.1) Potri.013G110700 [exp] 102 / 8e-26 AT1G35560 224 / 9e-70 TCP family transcription factor (.1) Potri.004G046300 [exp] 102 / 1e-25 AT3G47620 182 / 2e-52 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Potri.011G055500 [exp] 102 / 1e-25 AT3G47620 173 / 2e-49 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Potri.019G081800 [exp] 101 / 3e-25 AT1G72010 220 / 5e-68 TCP family transcription factor (.1) Potri.015G138200 [exp] 99 / 1e-24 AT5G51910 230 / 1e-73 TCP family transcription factor (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013814 [exp] 112 / 5e-31 AT3G47620 119 / 2e-32 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10037046 [exp] 97 / 3e-26 AT3G27010 145 / 5e-44 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10032022 [exp] 101 / 1e-25 AT3G27010 234 / 2e-75 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10015760 [exp] 99 / 2e-25 AT3G27010 181 / 1e-55 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10010177 [exp] 96 / 1e-23 AT5G23280 186 / 1e-57 TCP family transcription factor (.1) Lus10037190 [exp] 96 / 3e-23 AT1G69690 172 / 9e-50 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) Lus10041328 [exp] 86 / 1e-20 AT3G47620 93 / 3e-22 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10008621 [exp] 72 / 5e-15 AT3G47620 140 / 4e-38 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10035193 [exp] 70 / 8e-15 AT3G27010 156 / 6e-47 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10008444 [exp] 46 / 7e-07 AT1G58100 104 / 5e-28 TCP domain protein 8, TCP family transcription factor (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03634 [poplar] [flax] TCP TCP family transcription factor
Representative CDS sequence Show only first row Show all	>Potri.016G094800.1 pacid=42810522 polypeptide=Potri.016G094800.1.p locus=Potri.016G094800 ID=Potri.016G094800.1.v4.1 annot-version=v4.1 ATGGCTTCTGAAACCGTTCTCTACAACTTCTCCTCCACCTCAAACAGCCAACACCAACAGCCAAGCCCTAACAACAACAACTCTGTGGTCCCCTCACCCA CAACTGGTGGGTCCCAATCTAAGCTGACCCACCCTCGCAAATCAACTACCTCTCAATCCAAAGACCGCCACACCAAAGTCCATGGCCGTGGCAGGCGGGT TCGGATGCCCGCTTTAACAGCGGCCCGTATCTTCCAGCTCACCCGTGAGCTCGGCCACCGCTCCGATGGCGAGACCATCGAGTGGCTCCTTCGCCACGCT GAGGCATCCATCATCGCTTCCACCGGAACCGGCACTATCCCCTCCATCCCCATCTCCACCACCGTCGGGTCCACCCCGATTTCCTCCTCTTCTCCTTCTC CTTCTGCTTCCTGCAAGGTCCACCCCGTCAACTGTATAGGGCCCGAGATGTTCTCTCTGTTGACGGCACCCAGCAGCCGGCTTGACTTGGATTACAGGCA CATGCCGTTTACTGCTTTGTTGCTGCAGCCGATGGCGGCGACTGTGGCAGTGGATGCGGAGGAGGGTCGTCAGCAGGAGTTAACTGGGGAGCATAAGATG TAG
AA sequence Show only first row Show all	>Potri.016G094800.1 pacid=42810522 polypeptide=Potri.016G094800.1.p locus=Potri.016G094800 ID=Potri.016G094800.1.v4.1 annot-version=v4.1 MASETVLYNFSSTSNSQHQQPSPNNNNSVVPSPTTGGSQSKLTHPRKSTTSQSKDRHTKVHGRGRRVRMPALTAARIFQLTRELGHRSDGETIEWLLRHA EASIIASTGTGTIPSIPISTTVGSTPISSSSPSPSASCKVHPVNCIGPEMFSLLTAPSSRLDLDYRHMPFTALLLQPMAATVAVDAEEGRQQELTGEHKM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37000	TCP	TCP11	TCP family transcription facto...		Potri.016G094800 [exp]	0	1
AT5G07900			Mitochondrial transcription te...		Potri.001G035000 [exp]	3.46	0.9029
					Potri.008G005500 [exp]	4.89	0.8948
AT1G64950		CYP89A5	"cytochrome P450, family 89, s...		Potri.007G088154 [exp]	8.36	0.8994
AT3G14470			NB-ARC domain-containing disea...		Potri.018G017900 [exp]	10.72	0.8893	Pt-RGA.54
AT3G02780		IDI2, IPIAT1, I...	ATISOPENTENYL DIPHOSPHE ISOMER...		Potri.019G053700 [exp]	10.77	0.8563
AT3G07500	FAR1_related		Far-red impaired responsive (F...		Potri.007G128700 [exp]	11.22	0.8679
AT5G61220			LYR family of Fe/S cluster bio...		Potri.009G079800 [exp]	12.00	0.8817
AT2G31670			Stress responsive alpha-beta b...		Potri.001G413500 [exp]	13.19	0.8885
AT3G54826			Zim17-type zinc finger protein...		Potri.008G037300 [exp]	14.73	0.8840
AT5G52810			NAD(P)-binding Rossmann-fold s...		Potri.004G072500 [exp]	15.39	0.8984

Compare expression of checked genes

Potri.016G094800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.