Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09890 213 / 1e-70 Ankyrin repeat family protein (.1.2) AT2G17390 61 / 3e-11 AKR2B ankyrin repeat-containing 2B (.1) AT4G35450 60 / 9e-11 AKR2A, AFT, AKR2 ankyrin repeat-containing protein 2 (.1.2.3.4.5) AT2G25600 58 / 5e-10 AKT6, SPIK Shaker pollen inward K+ channel, Shaker pollen inward K+ channel (.1) AT4G19150 57 / 9e-10 Ankyrin repeat family protein (.1.2) AT5G12320 53 / 6e-09 ankyrin repeat family protein (.1) AT2G03430 54 / 1e-08 Ankyrin repeat family protein (.1) AT3G09550 53 / 3e-08 Ankyrin repeat family protein (.1) AT5G20350 53 / 3e-08 TIP1 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) AT5G40160 52 / 5e-08 EMB139, EMB506 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G121500 [exp] 312 / 7e-110 AT3G09890 196 / 1e-63 Ankyrin repeat family protein (.1.2) Potri.004G210000 [exp] 59 / 2e-10 AT2G17390 418 / 1e-146 ankyrin repeat-containing 2B (.1) Potri.004G210100 [exp] 59 / 2e-10 AT2G17390 430 / 3e-151 ankyrin repeat-containing 2B (.1) Potri.010G185200 [exp] 56 / 4e-09 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.009G070700 [exp] 52 / 1e-08 AT5G12320 197 / 6e-66 ankyrin repeat family protein (.1) Potri.013G062000 [exp] 52 / 8e-08 AT2G03430 94 / 2e-21 Ankyrin repeat family protein (.1) Potri.018G121200 [exp] 52 / 9e-08 AT5G20350 951 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Potri.003G103400 [exp] 50 / 3e-07 AT4G19150 234 / 2e-77 Ankyrin repeat family protein (.1.2) Potri.001G295200 [exp] 49 / 4e-07 AT5G40160 317 / 4e-108 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023911 [exp] 227 / 4e-76 AT3G09890 219 / 6e-73 Ankyrin repeat family protein (.1.2) Lus10014410 [exp] 225 / 2e-75 AT3G09890 217 / 5e-72 Ankyrin repeat family protein (.1.2) Lus10021508 [exp] 224 / 1e-74 AT3G09890 209 / 5e-69 Ankyrin repeat family protein (.1.2) Lus10022609 [exp] 187 / 3e-61 AT3G09890 181 / 1e-58 Ankyrin repeat family protein (.1.2) Lus10014522 [exp] 59 / 3e-10 AT5G40160 322 / 3e-109 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) Lus10001605 [exp] 59 / 5e-10 AT4G38130 833 / 0.0 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2) Lus10020505 [exp] 58 / 6e-10 AT2G14255 389 / 2e-131 Ankyrin repeat family protein with DHHC zinc finger domain (.1) Lus10013859 [exp] 57 / 1e-09 AT2G17390 427 / 1e-150 ankyrin repeat-containing 2B (.1) Lus10038108 [exp] 55 / 9e-09 AT5G20350 839 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Lus10032165 [exp] 53 / 3e-08 AT5G40160 293 / 3e-98 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [poplar] [flax] Ank PF12796 [poplar] [flax] Ank_2 Ankyrin repeats (3 copies)
Representative CDS sequence Show only first row Show all	>Potri.016G097900.1 pacid=42809259 polypeptide=Potri.016G097900.1.p locus=Potri.016G097900 ID=Potri.016G097900.1.v4.1 annot-version=v4.1 ATGGCAGTACACCGCGACAATCTACTGGAAGAAGAAGAGAACGAAGAAGACAATGCTCTGTTTGAGGGAGACGGCTTAGTTGACCAAGATTCCGATATTC CTCCTCACCTCCGTGACCTTGCCCGCGCCGCTCAGACCGGTGACGTCGACGCTCTTCGCTATGCTCTAGATAACCTGAATGGCAGCATTGATGAACCAGT GGAAGATGGGGACACGGCTCTCCATTTGACATGCCTGTATGGCTATTGTCCCTGTGTCCAGCTACTCCTGGAAAGGGGAGCAAACTTGGAGGCCAAGGAT GAAGAAGGGGCGATTCCTTTGCATGATGCCTGCGCAGGGGGATTTACTGAGATAGTCCAACTTCTGGTGAACAGTGCTAATAGTGCAGAGCGTGTGAAAA GGATGCTAGAGATAGTTGATGATGAGGGTGATACTCCTCTTCACCATGCAGCAAGAGGTGAACATGCCGATGTTATTAGATTGCTGCTGGCTTCTGGTGC CTCCGCTACAACAGCAAACTCATATGGAAAGACTCCAAGCGAACTACCTGAACCAGATACTGAAGCGCACAGAATTTTGGAATCGGCCGGATGA
AA sequence Show only first row Show all	>Potri.016G097900.1 pacid=42809259 polypeptide=Potri.016G097900.1.p locus=Potri.016G097900 ID=Potri.016G097900.1.v4.1 annot-version=v4.1 MAVHRDNLLEEEENEEDNALFEGDGLVDQDSDIPPHLRDLARAAQTGDVDALRYALDNLNGSIDEPVEDGDTALHLTCLYGYCPCVQLLLERGANLEAKD EEGAIPLHDACAGGFTEIVQLLVNSANSAERVKRMLEIVDDEGDTPLHHAARGEHADVIRLLLASGASATTANSYGKTPSELPEPDTEAHRILESAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09890			Ankyrin repeat family protein ...		Potri.016G097900 [exp]	0	1
AT3G11830			TCP-1/cpn60 chaperonin family ...		Potri.004G195300 [exp]	4.47	0.8161
AT4G20910		CRM2, HEN1	HUA ENHANCER 1, CORYMBOSA 2, d...		Potri.001G465500 [exp]	5.74	0.8059	HEN902,HEN1.2
AT1G15420			unknown protein		Potri.001G173300 [exp]	6.00	0.8216
AT1G04570			Major facilitator superfamily ...		Potri.010G063800 [exp]	7.61	0.8226
AT3G58180			ARM repeat superfamily protein...		Potri.005G221700 [exp]	8.18	0.7514
					Potri.014G079500 [exp]	9.16	0.8104
AT3G22450			Ribosomal L18p/L5e family prot...		Potri.008G153100 [exp]	10.19	0.8442
AT5G20510	Alfin	AL5	alfin-like 5 (.1)		Potri.018G050200 [exp]	11.40	0.8050
AT4G21800		QQT2	quatre-quart2, P-loop containi...		Potri.010G148000 [exp]	13.41	0.8067
AT2G35720		OWL1	ORIENTATION UNDER VERY LOW FLU...		Potri.001G158200 [exp]	14.49	0.7849

Compare expression of checked genes

Potri.016G097900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.