Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	XTH32.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36870 476 / 2e-171 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) AT3G44990 364 / 2e-127 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1) AT1G10550 199 / 2e-62 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1) AT1G14720 196 / 8e-61 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1) AT4G14130 194 / 1e-60 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT1G32170 195 / 3e-60 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1) AT3G23730 192 / 7e-60 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT5G57530 190 / 5e-59 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT5G57550 184 / 6e-57 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT5G57540 184 / 6e-57 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G122900 [exp] 530 / 0 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Potri.009G006600 [exp] 390 / 1e-137 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1) Potri.009G163850 [exp] 198 / 5e-62 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1) Potri.011G077320 [exp] 196 / 3e-61 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.006G170100 [exp] 195 / 5e-61 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G169900 [exp] 195 / 5e-61 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G170001 [exp] 195 / 5e-61 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.014G115000 [exp] 195 / 1e-60 AT1G10550 367 / 9e-128 xyloglucan:xyloglucosyl transferase 33 (.1) Potri.003G097300 [exp] 196 / 2e-60 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001396 [exp] 455 / 6e-163 AT2G36870 460 / 8e-165 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10023009 [exp] 455 / 6e-163 AT2G36870 466 / 3e-167 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10026535 [exp] 435 / 3e-155 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10013822 [exp] 434 / 1e-154 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10016144 [exp] 389 / 6e-137 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10037377 [exp] 389 / 7e-137 AT2G36870 422 / 9e-150 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10021422 [exp] 388 / 1e-136 AT2G36870 417 / 4e-148 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10041341 [exp] 387 / 2e-136 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10026536 [exp] 362 / 6e-126 AT2G36870 402 / 1e-141 xyloglucan endotransglucosylase/hydrolase 32 (.1.2) Lus10013823 [exp] 273 / 1e-92 AT2G36870 301 / 7e-104 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.016G098600.1 pacid=42810374 polypeptide=Potri.016G098600.1.p locus=Potri.016G098600 ID=Potri.016G098600.1.v4.1 annot-version=v4.1 ATGGCTCTCTTTCCCTTACTTCTTCTCATTCTTATGGTTCCTTCCTCTAGTAATGCTCAATGGCCACCTTCACCTGGCTACTGGCCAGGTTCTAGGTTCA GGTCAATGAGCTTTTACCAAGGATACAGAAATCTCTGGGGTTATTCACATCAACGAGTAGACCAGAATGCGTTGACTATCTGGCTAGATAGCACATCAGG GAGTGGATTTAAATCAGTTAAACCATTTCGATCAGGGTATTTTGGTGCTTCCATTAAGCTCCAACCTGGCTACACTGCGGGAGTTATAACAGCTTTCTAT CTTTCAAATAGCGAAGCTCACCCTGGGTACCATGATGAAGTGGACATAGAATTTCTTGGCACAACATTTGGGAAGCCTTACACTTTGCAGACCAATGTTT ACATCAGAGGAAGTGGGGATGGGAGAATCATTGGGAGAGAAATGAAGTTTCATTTATGGTTCGATCCAACCAAAACCTTCCATTATTATGCCATTCTTTG GAGTCCCAAGGAGATCATATTCCTCGTGGATGATGTGCCCGTTAGGAGGTACCCGAGGAAAAGCGCGACAACCTTTCCACTGAGGCCGATGTGGGTTTAC GGTTCCATCTGGGATGCCTCATCTTGGGCTACTGAAAACGGAAAATACAAAGCTGATTACAGATATCAACCATTTGTTGCTAGTTACACCAATTTCAAAG CAAGCGGCTGCTCAGCCTATTCACCGGCCTGGTGCCACCCTGTGTCCGCCTCTCCGTTCCGGTCGGGTGGGCTCACAAGGCAACAATATAGAAGCATGAG ATGGGTCCAAAGACACCACATGGTCTATGACTATTGCAAGGACTACAAGAGAGACCATTCCCTTACACCTGAGTGCTGGGGTTAG
AA sequence Show only first row Show all	>Potri.016G098600.1 pacid=42810374 polypeptide=Potri.016G098600.1.p locus=Potri.016G098600 ID=Potri.016G098600.1.v4.1 annot-version=v4.1 MALFPLLLLILMVPSSSNAQWPPSPGYWPGSRFRSMSFYQGYRNLWGYSHQRVDQNALTIWLDSTSGSGFKSVKPFRSGYFGASIKLQPGYTAGVITAFY LSNSEAHPGYHDEVDIEFLGTTFGKPYTLQTNVYIRGSGDGRIIGREMKFHLWFDPTKTFHYYAILWSPKEIIFLVDDVPVRRYPRKSATTFPLRPMWVY GSIWDASSWATENGKYKADYRYQPFVASYTNFKASGCSAYSPAWCHPVSASPFRSGGLTRQQYRSMRWVQRHHMVYDYCKDYKRDHSLTPECWG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Potri.016G098600 [exp]	0	1	XTH32.2
					Potri.012G031250 [exp]	2.00	0.9419
AT5G43250	CCAAT	NF-YC13	"nuclear factor Y, subunit C13...		Potri.001G055000 [exp]	2.44	0.9310
					Potri.014G192701 [exp]	2.44	0.9108
AT2G29125		RTFL2, DVL13	DEVIL 13, ROTUNDIFOLIA like 2 ...		Potri.009G034300 [exp]	3.00	0.9094
					Potri.003G076700 [exp]	4.89	0.9098
AT2G36985		DVL16, ROT4	ROTUNDIFOLIA4, DEVIL 16, DVL f...		Potri.006G125600 [exp]	6.00	0.9144	Pt-ROT4.1
					Potri.011G020275 [exp]	6.32	0.9027
AT1G67260	TCP	TCP1	TCP family transcription facto...		Potri.017G112000 [exp]	9.79	0.8826
AT4G14380			unknown protein		Potri.008G167200 [exp]	9.89	0.9100
AT4G39010		ATGH9B18	glycosyl hydrolase 9B18 (.1)		Potri.004G162200 [exp]	10.81	0.9247

Compare expression of checked genes

Potri.016G098600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.