Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37770 424 / 3e-150 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 415 / 1e-146 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 398 / 8e-140 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT3G53880 397 / 1e-139 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G01670 221 / 2e-70 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT5G62420 207 / 9e-65 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59950 197 / 3e-61 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 186 / 1e-56 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 178 / 1e-53 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 172 / 2e-51 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G102100 [exp] 514 / 0 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 439 / 6e-156 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.006G090600 [exp] 419 / 2e-148 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 361 / 3e-125 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.005G097000 [exp] 230 / 7e-74 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G193100 [exp] 219 / 2e-69 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.001G125400 [exp] 213 / 3e-67 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G144600 [exp] 202 / 2e-62 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.010G097800 [exp] 198 / 7e-61 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010885 [exp] 444 / 5e-158 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010884 [exp] 436 / 5e-155 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024354 [exp] 407 / 4e-140 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024353 [exp] 398 / 7e-140 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10021491 [exp] 369 / 1e-128 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10012652 [exp] 369 / 8e-127 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024350 [exp] 291 / 6e-95 AT3G53900 374 / 9e-128 PYRIMIDINE R, uracil phosphoribosyltransferase (.1.2) Lus10029208 [exp] 221 / 3e-70 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10027216 [exp] 219 / 1e-69 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010720 [exp] 219 / 2e-69 AT1G59960 410 / 2e-144 NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [poplar] [flax] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Potri.016G102032.1 pacid=42810664 polypeptide=Potri.016G102032.1.p locus=Potri.016G102032 ID=Potri.016G102032.1.v4.1 annot-version=v4.1 ATGGCCAAAGCCATTCCATTTTTTGAGCTCAACACTGGAGCTAAAATCCCTTCAGTTGGTTTGGGCACAGGGGGCGCTGACCCTGGTGCTGTCGCTGATG CTGTCACTGCTGCCATTAAGGCTGGATATAGACACATTGACTGCGCTCGACTTTACTGCAACGAGAAAGAGGTTGGTTGTGCATTGAAGAAATTATTTGA CAATGGGGTAGTAAAGCGTGGCGAAGTGTGGATCACTTCAAAACTCTGGTGTAATGATCATGCACCGGAAGATGTACCGGAGTCATTAGGGAAGACTTTG CAGGACTTGCAGCTTGACTATGTAGATCTGTATCTGATTCATTGGCCCGTCAGCATGAAGAAGGGTTCAGAGGGCTATAAGCCTGAAAACCTTACTCAAA CCAACATACCAGCAACGTGGAGAGCCATGGAGGCACTTTACGATTCTGGCAAGGCTCGTGCTATTGGAGTTAGTAATTTCTCATCAAAGAAGCTTGGGGA TTTGCTAGCCGCGGCTCGTGTACCTCCAGCTGTTAACCAAGTCGAATGTCACCCCGTGTGGCAGCAGCCAAAGCTTCATGAATTTTGTCAATCCAGGGGT GTCCATTTATCTGGGTATTCACCGCTAGGTTCCCCAGATGCAGGAACGATCAAGACCCAGGTTCTCAAGAATTCAATTCTTAATACGATTGCTGAGAAAT TAGGCAAATCTCCTGCGCAAGTAGCTCTTAGGTGGGGACTACAGATGGGCCACAGTGTGCTTCCTAAGAGCACAAATGAGGCAAGGATCAAGGAAAACCT TGACATTTTTGACTGGTCTATTCCTGAAGATTTGTTTGCCAAGTTATCTGGAATTGAACAGGAGAGGCTGGTTAAGGGCACTGTGTTTGTGCACGAGACT TATGGTTCATACAAGACACTCGACGAACTATGGGATGGTGAAACATCAGATGCCTGA
AA sequence Show only first row Show all	>Potri.016G102032.1 pacid=42810664 polypeptide=Potri.016G102032.1.p locus=Potri.016G102032 ID=Potri.016G102032.1.v4.1 annot-version=v4.1 MAKAIPFFELNTGAKIPSVGLGTGGADPGAVADAVTAAIKAGYRHIDCARLYCNEKEVGCALKKLFDNGVVKRGEVWITSKLWCNDHAPEDVPESLGKTL QDLQLDYVDLYLIHWPVSMKKGSEGYKPENLTQTNIPATWRAMEALYDSGKARAIGVSNFSSKKLGDLLAAARVPPAVNQVECHPVWQQPKLHEFCQSRG VHLSGYSPLGSPDAGTIKTQVLKNSILNTIAEKLGKSPAQVALRWGLQMGHSVLPKSTNEARIKENLDIFDWSIPEDLFAKLSGIEQERLVKGTVFVHET YGSYKTLDELWDGETSDA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Potri.016G102032 [exp]	0	1
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Potri.016G102100 [exp]	1.00	0.9942
AT5G13080	WRKY	ATWRKY75, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Potri.001G058800 [exp]	14.35	0.9771
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Potri.001G223800 [exp]	22.44	0.9745
AT3G12490		ATCYS6, ATCYSB	ARABIDOPSIS THALIANA PHYTOCYST...		Potri.001G225800 [exp]	23.91	0.9743
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Potri.008G179300 [exp]	24.81	0.9689	GAPDH.1
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.003G099000 [exp]	26.83	0.9722
AT3G60120		BGLU27	beta glucosidase 27 (.1)		Potri.001G224000 [exp]	30.24	0.9726
					Potri.001G194100 [exp]	36.37	0.9712
AT2G23620		ATMES1	ARABIDOPSIS THALIANA METHYL ES...		Potri.007G037033 [exp]	38.78	0.9713
					Potri.006G261022 [exp]	42.54	0.9710

Compare expression of checked genes

Potri.016G102032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.