SDH4.2 (Potri.016G102200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol SDH4.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02050 216 / 4e-70 Mitochondrial glycoprotein family protein (.1)
AT3G55605 177 / 6e-55 Mitochondrial glycoprotein family protein (.1)
AT2G39795 165 / 3e-50 Mitochondrial glycoprotein family protein (.1)
AT5G05990 147 / 3e-43 Mitochondrial glycoprotein family protein (.1)
AT2G39790 103 / 1e-26 Mitochondrial glycoprotein family protein (.1)
AT1G15870 102 / 4e-26 Mitochondrial glycoprotein family protein (.1)
AT1G80720 97 / 1e-24 Mitochondrial glycoprotein family protein (.1)
AT4G31930 78 / 5e-17 Mitochondrial glycoprotein family protein (.1)
AT4G32605 55 / 6e-09 Mitochondrial glycoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G090700 377 / 9e-134 AT5G02050 228 / 9e-75 Mitochondrial glycoprotein family protein (.1)
Potri.004G049600 224 / 2e-73 AT5G02050 96 / 4e-23 Mitochondrial glycoprotein family protein (.1)
Potri.010G198600 199 / 1e-63 AT2G39795 222 / 1e-72 Mitochondrial glycoprotein family protein (.1)
Potri.010G198500 184 / 1e-57 AT3G55605 210 / 1e-67 Mitochondrial glycoprotein family protein (.1)
Potri.001G047600 95 / 3e-23 AT1G15870 256 / 2e-86 Mitochondrial glycoprotein family protein (.1)
Potri.018G021600 89 / 2e-21 AT4G31930 259 / 1e-87 Mitochondrial glycoprotein family protein (.1)
Potri.008G015600 54 / 2e-08 AT4G32605 262 / 2e-88 Mitochondrial glycoprotein family protein (.1)
Potri.010G244500 53 / 3e-08 AT4G32605 242 / 3e-81 Mitochondrial glycoprotein family protein (.1)
Potri.006G046350 47 / 3e-06 AT2G41600 210 / 2e-69 Mitochondrial glycoprotein family protein (.1.2.3.4.5)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024351 259 / 3e-87 AT5G02050 231 / 6e-76 Mitochondrial glycoprotein family protein (.1)
Lus10030157 213 / 3e-69 AT3G55605 236 / 6e-78 Mitochondrial glycoprotein family protein (.1)
Lus10001015 210 / 4e-68 AT3G55605 232 / 1e-76 Mitochondrial glycoprotein family protein (.1)
Lus10012653 186 / 9e-60 AT5G02050 201 / 2e-65 Mitochondrial glycoprotein family protein (.1)
Lus10001017 184 / 2e-58 AT3G55605 199 / 2e-64 Mitochondrial glycoprotein family protein (.1)
Lus10024352 105 / 1e-27 AT5G02050 78 / 3e-17 Mitochondrial glycoprotein family protein (.1)
Lus10026060 102 / 6e-26 AT1G15870 263 / 4e-89 Mitochondrial glycoprotein family protein (.1)
Lus10017126 90 / 1e-21 AT4G31930 240 / 3e-80 Mitochondrial glycoprotein family protein (.1)
Lus10018327 82 / 1e-18 AT4G31930 243 / 2e-81 Mitochondrial glycoprotein family protein (.1)
Lus10012652 82 / 9e-18 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02330 MAM33 Mitochondrial glycoprotein
Representative CDS sequence
>Potri.016G102200.1 pacid=42809440 polypeptide=Potri.016G102200.1.p locus=Potri.016G102200 ID=Potri.016G102200.1.v4.1 annot-version=v4.1
ATGGCCTTCAACTCTGTACTTCGCCGAGCCTCGAAATCCCTCTTGCCTCTCGCTATCCGCGCCGTGGGAACTCCCAGAACCTTCCACAGAGCTATCCCCG
CCGTTCTCTCCGTTGAAAACCTCCGAGACTTTCTTCCATCTTCGCATTTCTCAACAGCTGCCACCGCGCTGAAACCAACCGCCGATGAGAATCTCATTCG
AGTCCTCGGAACTGAGATCGAATGCGTCGAGGAACCCCACGATGTGGAGAATATCTCGAATGAGTTTCCCTTCAAAATTAAAGATAATCCTGGAGAGAGG
ACCATTTTGCTAAGTCGAAAGTTCCAAGATGAAACCATCAAAATTGAAGTCGACATGCCTAGTATTTCAGATGATGATGATAATGATGATGATGATGATG
CGAAGGACGCAGATGTCTCTAGCATTCCGTTGGTTGTGAGTATTACCAAGGGAAGCGGTCAGTATATGGAGTTCTGTATCACTGCTTTCCATGATGAGAT
TTCAATTGATAGCTTGTCAATAAAAAACCTGGAAAATTCTGATGAACTTGCATATGAAGGACCTGACTTTAATGATTTGGATGAGAATCTGCAGAATGCT
TTCCTGAAGTATCTTGAGATTAGAGGCATCAAACCTAGCGTAACAAATGTTTTGTTTGATTACATGGCTAACAAAGATACCAAAGAATACTTGTTATGGC
TGAAGAACGTCAAGAATTTTGTGGAGAAGTAA
AA sequence
>Potri.016G102200.1 pacid=42809440 polypeptide=Potri.016G102200.1.p locus=Potri.016G102200 ID=Potri.016G102200.1.v4.1 annot-version=v4.1
MAFNSVLRRASKSLLPLAIRAVGTPRTFHRAIPAVLSVENLRDFLPSSHFSTAATALKPTADENLIRVLGTEIECVEEPHDVENISNEFPFKIKDNPGER
TILLSRKFQDETIKIEVDMPSISDDDDNDDDDDAKDADVSSIPLVVSITKGSGQYMEFCITAFHDEISIDSLSIKNLENSDELAYEGPDFNDLDENLQNA
FLKYLEIRGIKPSVTNVLFDYMANKDTKEYLLWLKNVKNFVEK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G02050 Mitochondrial glycoprotein fam... Potri.016G102200 0 1 SDH4.2
AT5G27395 Mitochondrial inner membrane t... Potri.013G026700 1.41 0.8963
AT4G21130 EMB2271 EMBRYO DEFECTIVE 2271, Transdu... Potri.005G061000 2.82 0.8819
AT4G21130 EMB2271 EMBRYO DEFECTIVE 2271, Transdu... Potri.007G107900 3.87 0.8733
AT3G15460 Ribosomal RNA processing Brix ... Potri.011G122200 5.91 0.8577
AT3G44750 HDT1, HDA3, ATH... HISTONE DEACETYLASE 2A, histon... Potri.009G149400 6.48 0.8625 HD2.2,HDT901
AT3G23620 Ribosomal RNA processing Brix ... Potri.015G088700 8.00 0.8513
AT5G67630 P-loop containing nucleoside t... Potri.016G096800 10.39 0.8473
AT1G80270 PPR596 PENTATRICOPEPTIDE REPEAT 596 (... Potri.016G036100 10.39 0.8331
AT4G13850 ATGRP2, GR-RBP2 glycine rich protein 2, glycin... Potri.001G319800 11.40 0.8324
AT5G14520 pescadillo-related (.1) Potri.004G121400 11.83 0.8455

Potri.016G102200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.