Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04590 158 / 2e-48 EMB2748 unknown protein AT4G18975 59 / 2e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4) AT4G21190 59 / 2e-11 EMB1417 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G103000 [exp] 228 / 9e-77 AT1G04590 300 / 9e-101 unknown protein Potri.006G091500 [exp] 215 / 6e-72 AT1G04590 272 / 3e-90 unknown protein Potri.011G076800 [exp] 62 / 2e-12 AT4G18975 320 / 2e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4) Potri.017G148700 [exp] 57 / 1e-10 AT4G21190 339 / 3e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015943 [exp] 163 / 1e-51 AT1G04590 284 / 3e-95 unknown protein Lus10019008 [exp] 160 / 6e-50 AT1G04590 281 / 5e-93 unknown protein Lus10009120 [exp] 53 / 4e-09 AT4G18975 198 / 1e-61 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4) Lus10028526 [exp] 51 / 1e-08 AT4G18975 327 / 7e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4) Lus10027535 [exp] 50 / 2e-08 AT4G21190 302 / 5e-103 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039292 [exp] 41 / 5e-05 AT4G21190 339 / 7e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G102800.2 pacid=42810186 polypeptide=Potri.016G102800.2.p locus=Potri.016G102800 ID=Potri.016G102800.2.v4.1 annot-version=v4.1 ATGGGAACTTATGCGCAGTTTATACGAGCATTAGATATGGACCACAGAGCAAAAGAAGCACATGAGTTTTGGTTGACGAAAATTGGTAGAGATCTTCATT CTGTGCCATGGAAGCTATGTAATCGCATGATATCTATATACTACAGAAACAACATGCTAGAGAATCTCATAAAGCTTTTCAAAGGGCTGGAAGCTTTTGA TCGTCAACCTCCAGAAAAATCCATAGTTCAAAAAGTGGCAGATTCATATGAGATGCTAGGCTTACTTGAAGAAAAGGAAAGGGTATTAGAGAAGTACAAT CATCTCTTCGTTGAGGCAGGGAAAGGGTATTAG
AA sequence Show only first row Show all	>Potri.016G102800.2 pacid=42810186 polypeptide=Potri.016G102800.2.p locus=Potri.016G102800 ID=Potri.016G102800.2.v4.1 annot-version=v4.1 MGTYAQFIRALDMDHRAKEAHEFWLTKIGRDLHSVPWKLCNRMISIYYRNNMLENLIKLFKGLEAFDRQPPEKSIVQKVADSYEMLGLLEEKERVLEKYN HLFVEAGKGY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G04590		EMB2748	unknown protein		Potri.016G102800 [exp]	0	1
AT1G54870			NAD(P)-binding Rossmann-fold s...		Potri.019G023900 [exp]	1.73	0.8237
AT3G55530		SDIR1	SALT- AND DROUGHT-INDUCED RING...		Potri.010G201500 [exp]	6.24	0.8232
AT5G47540			Mo25 family protein (.1)		Potri.010G155400 [exp]	8.12	0.7589
AT5G56110	MYB	MS188, ATMYB80,...	MALE STERILE 188, ARABIDOPSIS ...		Potri.001G470500 [exp]	16.24	0.7564
					Potri.006G276750 [exp]	16.73	0.8168
AT5G17260	NAC	ANAC086	NAC domain containing protein ...		Potri.012G023900 [exp]	19.18	0.8150
AT5G59100			Subtilisin-like serine endopep...		Potri.009G037900 [exp]	19.33	0.7943
					Potri.009G144550 [exp]	19.36	0.7514
AT2G23150		ATNRAMP3, NRAMP...	natural resistance-associated ...		Potri.007G050700 [exp]	20.34	0.7276	Pt-NRAMP3.2
					Potri.013G032950 [exp]	21.63	0.7345

Compare expression of checked genes

Potri.016G102800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.