Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53980 143 / 1e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G05960 135 / 3e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G37870 79 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 37 / 0.0008 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 37 / 0.001 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G061800 [exp] 135 / 1e-42 AT5G05960 155 / 3e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G196300 [exp] 134 / 9e-42 AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G141000 [exp] 93 / 2e-25 AT2G37870 121 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G100600 [exp] 86 / 5e-23 AT2G37870 122 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009872 [exp] 138 / 3e-43 AT5G05960 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004677 [exp] 135 / 4e-42 AT5G05960 142 / 8e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10000397 [exp] 131 / 2e-40 AT5G05960 138 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10031925 [exp] 74 / 2e-17 AT2G37870 133 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10040249 [exp] 42 / 6e-06 AT3G53980 42 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10006413 [exp] 41 / 5e-05 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10011358 [exp] 40 / 6e-05 AT1G27950 103 / 5e-28 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.016G104300.1 pacid=42809553 polypeptide=Potri.016G104300.1.p locus=Potri.016G104300 ID=Potri.016G104300.1.v4.1 annot-version=v4.1 ATGGAGGCTCCTCTTAAATTCATCGGTCTTCTGGGATTGCTTGTGCTTTTGAGTGTTGCTGGAGGGGCTGATGCTGCGGGGGAATGTGGAAAATCTTCCC CAGACAATGAAGCCATGAAGCTGGCTCCTTGTGCAGAAGCAGCACAAGATGAGAAAGCTGCTGTGTCAGACAGTTGCTGCCTTCAGGTGAAGAGAATGGG CCAGAAGCCAAGCTGTCTTTGTGCTGTAATGCTTTCAGACACTGCTAAGGCATCTGGAGTCAAGATTGAAACTGCCATTACCATCCCCAAACGTTGCAAC ATTGCCAACCGTCCAGTGGGATACAAGTGTGGAGGTTATACACTTCCATGA
AA sequence Show only first row Show all	>Potri.016G104300.1 pacid=42809553 polypeptide=Potri.016G104300.1.p locus=Potri.016G104300 ID=Potri.016G104300.1.v4.1 annot-version=v4.1 MEAPLKFIGLLGLLVLLSVAGGADAAGECGKSSPDNEAMKLAPCAEAAQDEKAAVSDSCCLQVKRMGQKPSCLCAVMLSDTAKASGVKIETAITIPKRCN IANRPVGYKCGGYTLP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53980			Bifunctional inhibitor/lipid-t...		Potri.016G104300 [exp]	0	1
AT5G24090		ATCHIA	chitinase A (.1)		Potri.012G033932 [exp]	1.00	0.9727
					Potri.016G098300 [exp]	1.41	0.9714
					Potri.013G007900 [exp]	3.00	0.9642
					Potri.010G230366 [exp]	3.16	0.9592
					Potri.008G028400 [exp]	6.63	0.9469
					Potri.010G015100 [exp]	6.92	0.9146
AT1G43650			nodulin MtN21 /EamA-like trans...		Potri.005G192100 [exp]	7.34	0.9339
AT5G65140		TPPJ	trehalose-6-phosphate phosphat...		Potri.002G094500 [exp]	7.61	0.9100
AT3G28960			Transmembrane amino acid trans...		Potri.008G086500 [exp]	7.74	0.9527
AT5G04390	C2H2ZnF		C2H2-type zinc finger family p...		Potri.008G032300 [exp]	9.64	0.8401

Compare expression of checked genes

Potri.016G104300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.