Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09270 196 / 2e-64 ATGSTU8 glutathione S-transferase TAU 8 (.1) AT2G29490 186 / 1e-60 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, glutathione S-transferase TAU 1 (.1) AT2G29480 179 / 7e-58 GST20, ATGSTU2 GLUTATHIONE S-TRANSFERASE 20, glutathione S-transferase tau 2 (.1) AT2G29460 178 / 2e-57 GST22, ATGSTU4 GLUTATHIONE S-TRANSFERASE 22, glutathione S-transferase tau 4 (.1) AT2G29420 178 / 3e-57 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) AT2G29470 176 / 2e-56 GST21, ATGSTU3 GLUTATHIONE S-TRANSFERASE 21, glutathione S-transferase tau 3 (.1) AT2G29440 173 / 2e-55 GST24, ATGSTU6 GLUTATHIONE S-TRANSFERASE 24, glutathione S-transferase tau 6 (.1) AT2G29450 173 / 2e-55 ATGSTU1, AT103-1A, ATGSTU5 ARABIDOPSIS THALIANA GLUTATHIONE S-TRANSFERASE TAU 1, glutathione S-transferase tau 5 (.1) AT1G78340 155 / 2e-48 ATGSTU22 glutathione S-transferase TAU 22 (.1) AT1G78380 153 / 2e-47 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G023200 [exp] 182 / 7e-59 AT3G09270 189 / 1e-60 glutathione S-transferase TAU 8 (.1) Potri.010G070900 [exp] 181 / 1e-58 AT2G29420 221 / 9e-73 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.012G052200 [exp] 181 / 2e-58 AT2G29420 220 / 2e-72 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.013G072400 [exp] 178 / 3e-57 AT3G09270 161 / 2e-49 glutathione S-transferase TAU 8 (.1) Potri.016G023340 [exp] 177 / 6e-57 AT2G29420 194 / 3e-62 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G061200 [exp] 177 / 7e-57 AT3G09270 202 / 8e-66 glutathione S-transferase TAU 8 (.1) Potri.006G024200 [exp] 176 / 1e-56 AT2G29420 188 / 4e-60 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.008G175100 [exp] 172 / 2e-55 AT2G29420 169 / 1e-52 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.008G174900 [exp] 168 / 2e-53 AT2G29420 184 / 1e-58 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021102 [exp] 209 / 2e-69 AT3G09270 245 / 2e-82 glutathione S-transferase TAU 8 (.1) Lus10021103 [exp] 202 / 5e-67 AT3G09270 250 / 1e-84 glutathione S-transferase TAU 8 (.1) Lus10016469 [exp] 192 / 6e-63 AT2G29420 230 / 2e-76 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10016471 [exp] 182 / 5e-59 AT2G29420 234 / 8e-78 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10040764 [exp] 176 / 2e-56 AT2G29420 229 / 6e-76 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10040761 [exp] 174 / 7e-56 AT2G29420 233 / 1e-77 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10016467 [exp] 171 / 1e-54 AT2G29420 207 / 2e-67 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10017208 [exp] 170 / 3e-54 AT3G09270 212 / 3e-69 glutathione S-transferase TAU 8 (.1) Lus10040727 [exp] 164 / 1e-51 AT2G29420 216 / 6e-71 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10001491 [exp] 162 / 3e-51 AT3G09270 185 / 5e-59 glutathione S-transferase TAU 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF02798 [poplar] [flax] GST_N Glutathione S-transferase, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.016G104500.1 pacid=42810578 polypeptide=Potri.016G104500.1.p locus=Potri.016G104500 ID=Potri.016G104500.1.v4.1 annot-version=v4.1 ATGGCTGAAGTGAAGTTGCTTGGAGCATGGGGAAGCCCTTTGAGTCGCAGAGTGGAGATGGCTCTTAAATTGAAAAGTGTTGAATATGAATACATAGAAG AAGATTTAGCTAATAAGAGCCCTTTGCTTCTCAAATACAACCCCATTCACAAGAAAGTCCCTGTCCTCCTCCACAACGGAAAAACAATGGCAGAGTCGCT TGTTATTCTTGAGTACATAGATGAAACTTGGAAGAGCAACCCCATCTTGCCTGAAGATCCTTATGACAAAGCCATGGCTCGATTCTGGGCTAAATTCATC GACGAGAAGTGTATGCCTGCAATATGGCAAATCATGCTGTCTAAAGAGAATGAACGTGAGAAGGCCATAGAAGAAGCAATTCAGCACCTGAAAACTTTGG AAAATGAGCTCAAAGACAAGAAATTCTTTGGGGGATAG
AA sequence Show only first row Show all	>Potri.016G104500.1 pacid=42810578 polypeptide=Potri.016G104500.1.p locus=Potri.016G104500 ID=Potri.016G104500.1.v4.1 annot-version=v4.1 MAEVKLLGAWGSPLSRRVEMALKLKSVEYEYIEEDLANKSPLLLKYNPIHKKVPVLLHNGKTMAESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFI DEKCMPAIWQIMLSKENEREKAIEEAIQHLKTLENELKDKKFFGG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Potri.016G104500 [exp]	0	1
AT5G44440			FAD-binding Berberine family p...		Potri.011G162666 [exp]	2.23	0.9509
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.006G171184 [exp]	3.46	0.9463
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.006G170800 [exp]	4.58	0.9434
AT2G40470	AS2	ASL11, LBD15	ASYMMETRIC LEAVES2-LIKE 11, LO...		Potri.019G127300 [exp]	5.00	0.9375
AT3G58000			VQ motif-containing protein (....		Potri.009G024200 [exp]	9.38	0.9424
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.003G099100 [exp]	14.96	0.9273
AT1G06150	bHLH	bHLH089, EMB144...	EMBRYO DEFECTIVE 1444, basic h...		Potri.006G090000 [exp]	18.16	0.9148
AT1G12890	AP2_ERF		Integrase-type DNA-binding sup...		Potri.019G088000 [exp]	20.44	0.9191	ERF62
AT5G16770	MYB	ATMYB9	myb domain protein 9 (.1.2)		Potri.003G094200 [exp]	22.49	0.9035
AT3G53510		ABCG20	ATP-binding cassette G20, ABC-...		Potri.002G156900 [exp]	22.80	0.9257

Compare expression of checked genes

Potri.016G104500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.