Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53990 228 / 7e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03270 178 / 5e-58 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 161 / 2e-51 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 73 / 9e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 71 / 1e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G09740 70 / 2e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 69 / 5e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G68300 63 / 5e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 62 / 6e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT5G54430 56 / 7e-10 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092700 [exp] 259 / 4e-90 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.004G075375 [exp] 190 / 1e-62 AT3G03270 243 / 9e-84 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.017G144301 [exp] 187 / 9e-62 AT3G03270 248 / 9e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G144100 [exp] 166 / 4e-53 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 74 / 5e-17 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 72 / 3e-16 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.002G196700 [exp] 72 / 3e-16 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.014G122000 [exp] 70 / 1e-15 AT3G62550 195 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 67 / 4e-14 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022602 [exp] 232 / 3e-79 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10017207 [exp] 227 / 3e-77 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021104 [exp] 226 / 5e-77 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10037761 [exp] 171 / 3e-55 AT3G17020 224 / 4e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10016900 [exp] 170 / 2e-50 AT3G17020 229 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10021501 [exp] 152 / 5e-48 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10009272 [exp] 76 / 2e-17 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 66 / 6e-14 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 65 / 2e-13 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 62 / 2e-12 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.016G104600.2 pacid=42810618 polypeptide=Potri.016G104600.2.p locus=Potri.016G104600 ID=Potri.016G104600.2.v4.1 annot-version=v4.1 ATGCCTGGAGACAGAAATCTTGGTGTGGCTATGGACTTCTCGCCGAGCAGCAGGAACGCTCTCAAATGGGCCATTGATAACTTGGTCGATGATGGGGACA CACTTTACCTCGTCAACGTCAATTCCAACTCCCTTGACGAGTCTCGTAACAAACTCTGGGCTGAGTCTGGGTGTCCTCTTATTCCTCTGGATGAGTTCAA GGATCCGGAGATTTTGAAAAACTATGGTGTTAAAGTAGATGCTGAAGTTCTAGATATGCTTGACACCATTTCACGACAGAAAAAGGTGAGAGTTGTTTCA AAACTGTATTGGGGAGGAGATGCCAGAGAGAAGCTTCTTGATGCAGTCCAAGATCTGAAGCTGGACTCTTTGGTCATGGGAAGCAGGGGACTTGGCACTG TTCAAAGGATACTGTTGGGGAGTGTGAGCGCTTATGTGATGGCCAATGCTCCATGCCCTGTGACCATCGTCAAGGAAAAGCACTGA
AA sequence Show only first row Show all	>Potri.016G104600.2 pacid=42810618 polypeptide=Potri.016G104600.2.p locus=Potri.016G104600 ID=Potri.016G104600.2.v4.1 annot-version=v4.1 MPGDRNLGVAMDFSPSSRNALKWAIDNLVDDGDTLYLVNVNSNSLDESRNKLWAESGCPLIPLDEFKDPEILKNYGVKVDAEVLDMLDTISRQKKVRVVS KLYWGGDAREKLLDAVQDLKLDSLVMGSRGLGTVQRILLGSVSAYVMANAPCPVTIVKEKH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53990			Adenine nucleotide alpha hydro...		Potri.016G104600 [exp]	0	1
AT5G61510			GroES-like zinc-binding alcoho...		Potri.004G233800 [exp]	1.00	0.8926	Pt-TED2.2
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Potri.011G022500 [exp]	2.64	0.8706
AT2G48020			Major facilitator superfamily ...		Potri.002G212900 [exp]	4.69	0.8897
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.004G056500 [exp]	9.21	0.8734
AT5G47470			Nodulin MtN21 /EamA-like trans...		Potri.001G157600 [exp]	10.09	0.8712
AT1G54570			Esterase/lipase/thioesterase f...		Potri.013G033000 [exp]	10.39	0.8734
AT1G25520			Uncharacterized protein family...		Potri.008G117900 [exp]	11.48	0.8774
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.004G056000 [exp]	11.95	0.8602
AT3G24170		ATGR1	glutathione-disulfide reductas...		Potri.003G178200 [exp]	16.58	0.8512	GR.1
					Potri.001G077280 [exp]	19.89	0.8655

Compare expression of checked genes

Potri.016G104600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.