Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05830 191 / 2e-61 RING/FYVE/PHD zinc finger superfamily protein (.1) AT2G37950 162 / 6e-50 RING/FYVE/PHD zinc finger superfamily protein (.1) AT5G01070 155 / 1e-47 RING/FYVE/PHD zinc finger superfamily protein (.1.2) AT5G59000 113 / 1e-30 RING/FYVE/PHD zinc finger superfamily protein (.1) AT2G34200 72 / 2e-15 RING/FYVE/PHD zinc finger superfamily protein (.1) AT5G60580 66 / 2e-12 RING/U-box superfamily protein (.1.2.3.4) AT2G45530 62 / 2e-11 RING/U-box superfamily protein (.1) AT3G06330 58 / 6e-10 RING/U-box superfamily protein (.1.2.3) AT5G03180 58 / 1e-09 RING/U-box superfamily protein (.1.2) AT3G09760 57 / 3e-09 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G094000 [exp] 347 / 1e-122 AT5G05830 192 / 8e-62 RING/FYVE/PHD zinc finger superfamily protein (.1) Potri.010G195100 [exp] 204 / 2e-66 AT5G05830 206 / 9e-68 RING/FYVE/PHD zinc finger superfamily protein (.1) Potri.008G062600 [exp] 199 / 2e-64 AT5G05830 211 / 7e-70 RING/FYVE/PHD zinc finger superfamily protein (.1) Potri.009G039700 [exp] 145 / 1e-43 AT5G05830 159 / 2e-49 RING/FYVE/PHD zinc finger superfamily protein (.1) Potri.001G246700 [exp] 136 / 2e-40 AT5G59000 159 / 2e-49 RING/FYVE/PHD zinc finger superfamily protein (.1) Potri.004G059200 [exp] 92 / 2e-21 AT5G05830 107 / 3e-27 RING/FYVE/PHD zinc finger superfamily protein (.1) Potri.011G068800 [exp] 89 / 1e-20 AT5G05830 91 / 4e-21 RING/FYVE/PHD zinc finger superfamily protein (.1) Potri.006G024000 [exp] 65 / 4e-12 AT5G60580 361 / 4e-120 RING/U-box superfamily protein (.1.2.3.4) Potri.016G022900 [exp] 64 / 1e-11 AT5G60580 337 / 7e-111 RING/U-box superfamily protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017197 [exp] 214 / 6e-70 AT5G05830 182 / 1e-57 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10027744 [exp] 189 / 3e-60 AT5G05830 162 / 8e-50 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10035549 [exp] 183 / 9e-58 AT5G05830 157 / 4e-48 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10021113 [exp] 175 / 3e-55 AT5G05830 167 / 7e-53 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10040240 [exp] 169 / 9e-53 AT5G05830 187 / 4e-60 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10028249 [exp] 167 / 1e-51 AT5G05830 184 / 8e-59 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10016451 [exp] 138 / 8e-41 AT5G05830 164 / 1e-51 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10040716 [exp] 135 / 1e-39 AT5G05830 159 / 1e-49 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10007293 [exp] 103 / 8e-27 AT2G34200 103 / 6e-27 RING/FYVE/PHD zinc finger superfamily protein (.1) Lus10029242 [exp] 102 / 2e-26 AT5G05830 101 / 3e-26 RING/FYVE/PHD zinc finger superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF12906 [poplar] [flax] RINGv RING-variant domain
Representative CDS sequence Show only first row Show all	>Potri.016G105900.2 pacid=42809986 polypeptide=Potri.016G105900.2.p locus=Potri.016G105900 ID=Potri.016G105900.2.v4.1 annot-version=v4.1 ATGTCAGTTCATGAAATGTCCCACATCGATTTAGAGAAAGGAACACACCGCCGCTCCGTTGCTGGAAGTGATGCCAGTTGTTTTTCTGATGCAGAAGATG GGTCTTGCTACTCCCAGTTCTATTCAACCACTGGTGGGTCTTATGATAATTACAGTTTCGCTTGTGTCTCTGATCCTGAGGGTATAAACAGTGTGGTTTT GGATTCTAGGAGGGTGTCTTCAGTGTCTGATTGTTCAGTGGAGGTGGGGATTGTAAATGGGGTGCCTGAAATAAAGGTGCATTTGAGTAAAGTGGAGAGA GATTGTAGGATTTGCCATCTGGGTTTAGAGAGTAATAGCCATGAATCAGGAGTTCCTATTGAATTGGGTTGTTCTTGCAAGGATGATTTGGCTGCTGCTC ATAAACAGTGTGCAGAGGCTTGGTTCAAGATTAAGGGAAACAAGACCTGTGAGATTTGTCATTCTATTGCACGCAATGTTGTTTTAGCAAGTGACATCGA GTCAATTGAGCATTCAAATGAGACAAACAATGTCATGGTAAATACCGCGGCGGCAGCAGCCTCAACATCAATTCCTACCACAGAAACTCGAAGCTTTTGG CAAGGCCACCGCTTCCTGAATTTCTTGCTTGCTTGTGTGGTATTTGCATTTATATTATCTTGGCTCTTTCACTTCAATGTGCCATCCTCCTCGTAA
AA sequence Show only first row Show all	>Potri.016G105900.2 pacid=42809986 polypeptide=Potri.016G105900.2.p locus=Potri.016G105900 ID=Potri.016G105900.2.v4.1 annot-version=v4.1 MSVHEMSHIDLEKGTHRRSVAGSDASCFSDAEDGSCYSQFYSTTGGSYDNYSFACVSDPEGINSVVLDSRRVSSVSDCSVEVGIVNGVPEIKVHLSKVER DCRICHLGLESNSHESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICHSIARNVVLASDIESIEHSNETNNVMVNTAAAAASTSIPTTETRSFW QGHRFLNFLLACVVFAFILSWLFHFNVPSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05830			RING/FYVE/PHD zinc finger supe...		Potri.016G105900 [exp]	0	1
AT5G51790	bHLH	bHLH120	basic helix-loop-helix (bHLH) ...		Potri.015G134400 [exp]	2.44	0.8961
					Potri.019G108700 [exp]	4.24	0.8830
AT4G35785			RNA-binding (RRM/RBD/RNP motif...		Potri.001G101500 [exp]	4.69	0.8842
AT5G36930			Disease resistance protein (TI...		Potri.019G019710 [exp]	5.65	0.8510
					Potri.002G182100 [exp]	6.63	0.8814
AT3G26320		CYP71B36	"cytochrome P450, family 71, s...		Potri.008G184400 [exp]	8.12	0.8745	CYP71B40-1
AT3G58480			calmodulin-binding family prot...		Potri.015G125950 [exp]	11.22	0.8192
AT1G27170			transmembrane receptors;ATP bi...		Potri.005G004100 [exp]	11.66	0.8658
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Potri.012G113100 [exp]	12.72	0.8612
AT5G36930			Disease resistance protein (TI...		Potri.019G019053 [exp]	12.96	0.8715

Compare expression of checked genes

Potri.016G105900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.