Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48750 59 / 8e-12 CDKA1, CDC2A, CDKA;1, CDC2AAT, CDK2 cell division control 2 (.1) AT1G66750 59 / 9e-12 CDKD1;2, CAK4AT, AT;CDKD;2, CDKD;2 CYCLIN-DEPENDENT KINASE D1;2, CDK-activating kinase 4 (.1) AT1G18040 59 / 1e-11 CDKD1;3, AT;CDCKD;3, CAK2AT cyclin-dependent kinase D1;3 (.1) AT1G73690 54 / 1e-09 CDKD1;1, AT;CDKD;1, CAK3AT cyclin-dependent kinase D1;1 (.1) AT5G45430 49 / 3e-08 Protein kinase superfamily protein (.1.2) AT3G61960 48 / 1e-07 Protein kinase superfamily protein (.1.2) AT4G32830 47 / 2e-07 ATAUR1 ataurora1 (.1) AT1G33770 47 / 2e-07 Protein kinase superfamily protein (.1) AT1G69220 47 / 2e-07 SIK1 Protein kinase superfamily protein (.1.2) AT5G50860 47 / 2e-07 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G133500 [exp] 62 / 1e-12 AT3G48750 540 / 0.0 cell division control 2 (.1) Potri.012G052100 [exp] 56 / 2e-10 AT1G18040 562 / 0.0 cyclin-dependent kinase D1;3 (.1) Potri.014G079100 [exp] 55 / 5e-10 AT1G73690 573 / 0.0 cyclin-dependent kinase D1;1 (.1) Potri.002G181000 [exp] 49 / 5e-08 AT3G61960 592 / 0.0 Protein kinase superfamily protein (.1.2) Potri.002G065100 [exp] 48 / 9e-08 AT1G54610 435 / 2e-146 Protein kinase superfamily protein (.1.2.3) Potri.007G077600 [exp] 48 / 1e-07 AT1G54610 451 / 8e-153 Protein kinase superfamily protein (.1.2.3) Potri.004G226900 [exp] 47 / 2e-07 AT1G09600 731 / 0.0 Protein kinase superfamily protein (.1) Potri.008G204400 [exp] 47 / 2e-07 AT1G54610 719 / 0.0 Protein kinase superfamily protein (.1.2.3) Potri.013G032200 [exp] 47 / 2e-07 AT1G54610 787 / 0.0 Protein kinase superfamily protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038755 [exp] 60 / 6e-12 AT3G48750 468 / 7e-169 cell division control 2 (.1) Lus10017371 [exp] 56 / 2e-10 AT1G18040 564 / 0.0 cyclin-dependent kinase D1;3 (.1) Lus10040530 [exp] 56 / 3e-10 AT1G18040 593 / 0.0 cyclin-dependent kinase D1;3 (.1) Lus10025986 [exp] 50 / 2e-08 AT2G18170 617 / 0.0 MAP kinase 7 (.1) Lus10005135 [exp] 49 / 5e-08 AT3G61960 632 / 0.0 Protein kinase superfamily protein (.1.2) Lus10038754 [exp] 49 / 8e-08 AT3G48750 407 / 2e-144 cell division control 2 (.1) Lus10030182 [exp] 49 / 8e-08 AT3G61960 617 / 0.0 Protein kinase superfamily protein (.1.2) Lus10014283 [exp] 48 / 9e-08 AT2G18170 611 / 0.0 MAP kinase 7 (.1) Lus10006033 [exp] 47 / 3e-07 AT4G32830 488 / 2e-175 ataurora1 (.1) Lus10005487 [exp] 47 / 3e-07 AT4G32830 545 / 0.0 ataurora1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.016G106725.1 pacid=42809171 polypeptide=Potri.016G106725.1.p locus=Potri.016G106725 ID=Potri.016G106725.1.v4.1 annot-version=v4.1 ATGGACAGTTGTCCACTAGGAGGAGCCTATGGAATTGTTTATTCAGCTACTGACAGAGCTACTAATCAAGGGGTAGCTGTGAAAATAATTCCTTTTTTGC AGGCTGAAATTACCAAGAGGTTGGCTAGAGAGATCTATCTGCTGTATGAAATAGAACATCCCAACATTGTCAGGTTACAACGCGCTTTCTTTCATGATGA CAAGCTGTGCTTGGTGTTTGAGCTCTTCAGTTGCAATATGAGAGAGCTTTTGGGGCAGGATCACAGAAATTCAAATATCCAGACATAG
AA sequence Show only first row Show all	>Potri.016G106725.1 pacid=42809171 polypeptide=Potri.016G106725.1.p locus=Potri.016G106725 ID=Potri.016G106725.1.v4.1 annot-version=v4.1 MDSCPLGGAYGIVYSATDRATNQGVAVKIIPFLQAEITKRLAREIYLLYEIEHPNIVRLQRAFFHDDKLCLVFELFSCNMRELLGQDHRNSNIQT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G66750		CDKD1;2, CAK4AT...	CYCLIN-DEPENDENT KINASE D1;2, ...		Potri.016G106725 [exp]	0	1
AT3G06740	GATA	GATA15	GATA transcription factor 15 (...		Potri.005G020500 [exp]	16.73	0.8055
AT1G51310			transferases;tRNA (5-methylami...		Potri.001G259000 [exp]	21.90	0.7871
AT1G76560		CP12-3	CP12 domain-containing protein...		Potri.005G258400 [exp]	30.29	0.7375
AT1G21640		ATNADK2, NADK2,...	NAD kinase 2 (.1.2)		Potri.005G182600 [exp]	38.70	0.7805	Pt-NADK2.1
AT4G16515		RGF6	root meristem growth factor 6,...		Potri.007G077300 [exp]	44.29	0.7172
AT5G65760			Serine carboxypeptidase S28 fa...		Potri.007G008100 [exp]	52.51	0.6974
AT3G52170			DNA binding (.1.2)		Potri.008G029500 [exp]	74.47	0.7345
AT4G17790			SNARE associated Golgi protein...		Potri.003G094000 [exp]	105.83	0.6971
AT2G28605			Photosystem II reaction center...		Potri.005G068500 [exp]	123.59	0.7350
AT1G23180			ARM repeat superfamily protein...		Potri.010G110200 [exp]	130.30	0.7343

Compare expression of checked genes

Potri.016G106725 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.