Potri.016G110400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
AT3G57810 90 / 2e-21 Cysteine proteinases superfamily protein (.1.2.3)
AT1G50670 42 / 0.0002 OTU-like cysteine protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G050900 89 / 1e-20 AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G057400 82 / 3e-18 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G177400 77 / 1e-17 AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3)
Potri.010G234300 72 / 7e-15 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G026100 72 / 1e-14 AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.009G160100 41 / 0.0005 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027758 274 / 2e-93 AT2G38025 227 / 4e-75 Cysteine proteinases superfamily protein (.1)
Lus10035535 157 / 2e-48 AT2G38025 112 / 5e-31 Cysteine proteinases superfamily protein (.1)
Lus10020438 90 / 4e-21 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3)
Lus10015803 75 / 8e-17 AT3G57810 215 / 3e-71 Cysteine proteinases superfamily protein (.1.2.3)
Lus10037002 74 / 1e-16 AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3)
Lus10008986 77 / 2e-16 AT3G57810 187 / 9e-58 Cysteine proteinases superfamily protein (.1.2.3)
Lus10028840 76 / 9e-16 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3)
Lus10021738 65 / 1e-13 AT2G38025 58 / 3e-11 Cysteine proteinases superfamily protein (.1)
Lus10040897 48 / 2e-06 AT3G62940 359 / 1e-124 Cysteine proteinases superfamily protein (.1.2.3)
Lus10005939 47 / 4e-06 AT3G62940 363 / 9e-126 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.016G110400.2 pacid=42809311 polypeptide=Potri.016G110400.2.p locus=Potri.016G110400 ID=Potri.016G110400.2.v4.1 annot-version=v4.1
ATGGCGGAGAAGTCCACAAACGAGCATATTTTAGAGCAGCTGAAACATGGGTTTGCCCATTTTGAGCTCGTCTCTTCCCCACTTCCTTCAATTTCCACCT
CCAAACCTCACTCATTTCCTCCGCCTTTCTTCTCTGCCAACACCCATCGCTTCTTCGCTAGAATCGGGCCTTCACTGGGTTCACATTCGATGAAAAAAGT
AGAGCATTATTCAGTTCAGAAAGTTACCGGAGATGGGCGCTGTCTATTTCGTTCTCTGGTCAAAGGAATGGCTTTCAACAAGGGCATCTCTCTTAATCCA
CGAGAAGAGAGAAATAATGCAGATGAACTACGAATGGCTGTGAAAGAGGTTATATGTGATAGTAAAGAAGAACGCAAACAGTACGAAGAAGCAGTTATTG
CAATCACGGTTGATGAGTCTTTGAAACGTTACTGCCAACGCATTCAGCGACCTGATTTTTGGGGAGGCGAGTCAGAGCTACTGGTGCTGTCAAGATTGTG
TAATCAGCCAATCATTGTTTACATACCAGAGCATGAGCACGCCAGTGGTGGGTGGGGCTCTGGCTTTATTCCCATAGCAGAGTACGGAGCTGAGTTCCAG
AAGGGCTCTTGGAAGGGAAAGCCAAGGAAAGCTGTGAGGCTACTGTACAGTGGTAAGAATCATTACGACTTGCTTGTCTGA
AA sequence
>Potri.016G110400.2 pacid=42809311 polypeptide=Potri.016G110400.2.p locus=Potri.016G110400 ID=Potri.016G110400.2.v4.1 annot-version=v4.1
MAEKSTNEHILEQLKHGFAHFELVSSPLPSISTSKPHSFPPPFFSANTHRFFARIGPSLGSHSMKKVEHYSVQKVTGDGRCLFRSLVKGMAFNKGISLNP
REERNNADELRMAVKEVICDSKEERKQYEEAVIAITVDESLKRYCQRIQRPDFWGGESELLVLSRLCNQPIIVYIPEHEHASGGWGSGFIPIAEYGAEFQ
KGSWKGKPRKAVRLLYSGKNHYDLLV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G38025 Cysteine proteinases superfami... Potri.016G110400 0 1
AT1G54500 Rubredoxin-like superfamily pr... Potri.005G049000 2.00 0.9876
AT3G02660 EMB2768 EMBRYO DEFECTIVE 2768, Tyrosyl... Potri.014G140400 2.82 0.9765
AT3G18870 Mitochondrial transcription te... Potri.004G150600 3.46 0.9838
AT2G21350 RNA-binding CRS1 / YhbY (CRM) ... Potri.009G122500 4.47 0.9727
AT3G09250 Nuclear transport factor 2 (NT... Potri.016G105600 6.00 0.9732
AT1G23400 CAF2, ATCAF2 ARABIDOPSIS THALIANA HOMOLOG O... Potri.010G042500 6.92 0.9745
AT2G21530 FHA SMAD/FHA domain-containing pro... Potri.009G156900 7.07 0.9753
AT3G54210 Ribosomal protein L17 family p... Potri.006G113500 7.14 0.9778
AT3G54090 FLN1 fructokinase-like 1 (.1) Potri.016G109600 7.93 0.9744
AT1G32580 plastid developmental protein ... Potri.010G068300 8.48 0.9703

Potri.016G110400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.