Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01520 339 / 6e-119 AtAIRP2, AIRP2 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) AT3G47160 323 / 2e-112 RING/U-box superfamily protein (.1.2) AT5G58787 303 / 1e-104 RING/U-box superfamily protein (.1.2) AT1G24440 206 / 1e-66 RING/U-box superfamily protein (.1) AT1G13195 196 / 2e-62 RING/U-box superfamily protein (.1.2) AT2G20030 46 / 1e-05 RING/U-box superfamily protein (.1) AT5G05280 44 / 3e-05 RING/U-box superfamily protein (.1) AT5G41350 44 / 4e-05 RING/U-box superfamily protein (.1) AT3G48030 44 / 5e-05 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1) AT3G10910 43 / 7e-05 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G099600 [exp] 405 / 6e-145 AT5G01520 324 / 4e-113 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) Potri.004G041200 [exp] 345 / 3e-121 AT3G47160 313 / 1e-108 RING/U-box superfamily protein (.1.2) Potri.011G050700 [exp] 341 / 1e-119 AT3G47160 311 / 5e-108 RING/U-box superfamily protein (.1.2) Potri.009G045400 [exp] 340 / 3e-119 AT3G47160 381 / 1e-135 RING/U-box superfamily protein (.1.2) Potri.001G250800 [exp] 328 / 9e-115 AT3G47160 344 / 4e-121 RING/U-box superfamily protein (.1.2) Potri.010G053000 [exp] 219 / 1e-71 AT1G13195 235 / 1e-77 RING/U-box superfamily protein (.1.2) Potri.008G181300 [exp] 218 / 3e-71 AT1G24440 352 / 1e-123 RING/U-box superfamily protein (.1) Potri.010G052700 [exp] 213 / 3e-69 AT1G24440 349 / 1e-122 RING/U-box superfamily protein (.1) Potri.012G093300 [exp] 209 / 1e-67 AT1G24440 312 / 4e-108 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002491 [exp] 377 / 5e-134 AT5G01520 386 / 1e-137 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) Lus10004821 [exp] 377 / 8e-134 AT5G01520 387 / 5e-138 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) Lus10001209 [exp] 337 / 3e-118 AT3G47160 369 / 9e-131 RING/U-box superfamily protein (.1.2) Lus10005859 [exp] 337 / 4e-118 AT3G47160 372 / 5e-132 RING/U-box superfamily protein (.1.2) Lus10011390 [exp] 221 / 1e-72 AT3G47160 233 / 3e-77 RING/U-box superfamily protein (.1.2) Lus10037053 [exp] 220 / 5e-72 AT3G47160 234 / 1e-77 RING/U-box superfamily protein (.1.2) Lus10006447 [exp] 220 / 6e-72 AT3G47160 233 / 5e-77 RING/U-box superfamily protein (.1.2) Lus10036934 [exp] 220 / 9e-72 AT3G47160 239 / 2e-79 RING/U-box superfamily protein (.1.2) Lus10036937 [exp] 216 / 3e-70 AT1G24440 332 / 5e-116 RING/U-box superfamily protein (.1) Lus10006253 [exp] 211 / 3e-68 AT1G13195 336 / 4e-117 RING/U-box superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13920 [poplar] [flax] zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Potri.016G115300.1 pacid=42810622 polypeptide=Potri.016G115300.1.p locus=Potri.016G115300 ID=Potri.016G115300.1.v4.1 annot-version=v4.1 ATGAGGAAATCGTTTAAGGATTCTCTTAAAGCTCTTGAAGCTGATATTCACTTTGCCAATACTCTGGCTTCTGATTATCCTAGGGAATATGATGGTGCCT GCCTTCAAATGAGATTATCCTACAGCCCTGCTGCCAACTTCTTTCTTTTTCTTGTCCAGTGGACTGATTGTCACCTAGCTGGTGCCTTGGGATTGCTTAG AATTCTTATATACAAGGCTTATGAGGATGGAAAGACAACCATGTCTATTTATGAAAGAAAGGCTAGCATAAGAGAGTTTTATGGGGTGATATTTCCTTCT TTATTGCAACTTGAAAGAGGAATCACTGATGTAGAAGACAGAAAGCAAAAAGAAATTTGTGCAAAGTACAAAAAGAAAGACGAAATGGACAAAGGAAAGC TCTCTGAAATTGATTTAGAGAGAGAGGAAGAATGTGGTATTTGCATGGAGATTAATAGCAGAGTTGTATTGCCCAAGTGCAATCATGCAATGTGTATGAA GTGCTATCGAGATTGGCGTACGCGCTCTCAATCATGTCCTTTCTGTCGAGACAGTCTCAAGAGAGTCAACTCAGGTGACCTTTGGATCTACACCAACAAC AATGAGATCATTGACTTGTCTTCAATCACTAGACAGAACTTGAAAAGACTGTTCATGTACATTGATAAGTTGCCACTCATTGTTCCTGAACCAATGTTTG TTTCTTACGACCCCCGTTACCGGTGA
AA sequence Show only first row Show all	>Potri.016G115300.1 pacid=42810622 polypeptide=Potri.016G115300.1.p locus=Potri.016G115300 ID=Potri.016G115300.1.v4.1 annot-version=v4.1 MRKSFKDSLKALEADIHFANTLASDYPREYDGACLQMRLSYSPAANFFLFLVQWTDCHLAGALGLLRILIYKAYEDGKTTMSIYERKASIREFYGVIFPS LLQLERGITDVEDRKQKEICAKYKKKDEMDKGKLSEIDLEREEECGICMEINSRVVLPKCNHAMCMKCYRDWRTRSQSCPFCRDSLKRVNSGDLWIYTNN NEIIDLSSITRQNLKRLFMYIDKLPLIVPEPMFVSYDPRYR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G01520		AtAIRP2, AIRP2	ABA Insensitive RING Protein 2...		Potri.016G115300 [exp]	0	1
AT5G47635			Pollen Ole e 1 allergen and ex...		Potri.016G006200 [exp]	2.00	0.9003
AT5G47635			Pollen Ole e 1 allergen and ex...		Potri.006G005600 [exp]	2.64	0.9118
AT2G47500			P-loop nucleoside triphosphate...		Potri.005G021100 [exp]	4.00	0.9084
AT5G62200			Embryo-specific protein 3, (AT...		Potri.015G132700 [exp]	6.32	0.8696
AT3G23090			TPX2 (targeting protein for Xk...		Potri.008G162800 [exp]	6.92	0.8994
AT5G43150			unknown protein		Potri.008G152200 [exp]	7.00	0.8906
AT3G52790			peptidoglycan-binding LysM dom...		Potri.008G030200 [exp]	9.79	0.8873
AT5G22400			Rho GTPase activating protein ...		Potri.006G211200 [exp]	11.00	0.8694
AT4G24990		ATGP4	Ubiquitin family protein (.1)		Potri.012G103100 [exp]	11.61	0.8719
AT2G20740			Tetraspanin family protein (.1...		Potri.019G101800 [exp]	12.96	0.8608

Compare expression of checked genes

Potri.016G115300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.