Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11210 58 / 2e-11 SGNH hydrolase-type esterase superfamily protein (.1) AT2G38180 53 / 1e-09 SGNH hydrolase-type esterase superfamily protein (.1) AT5G62930 39 / 8e-05 SGNH hydrolase-type esterase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G116100 [exp] 76 / 2e-18 AT3G11210 337 / 9e-118 SGNH hydrolase-type esterase superfamily protein (.1) Potri.006G100300 [exp] 71 / 4e-16 AT3G11210 327 / 8e-114 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G116000 [exp] 61 / 2e-12 AT3G11210 306 / 1e-105 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G115800 [exp] 60 / 2e-12 AT3G11210 307 / 4e-106 SGNH hydrolase-type esterase superfamily protein (.1) Potri.008G068000 [exp] 57 / 4e-11 AT3G11210 419 / 5e-150 SGNH hydrolase-type esterase superfamily protein (.1) Potri.010G189300 [exp] 55 / 2e-10 AT3G11210 414 / 4e-148 SGNH hydrolase-type esterase superfamily protein (.1) Potri.012G081900 [exp] 42 / 9e-06 AT5G62930 403 / 3e-144 SGNH hydrolase-type esterase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004815 [exp] 64 / 1e-13 AT3G11210 323 / 3e-112 SGNH hydrolase-type esterase superfamily protein (.1) Lus10028290 [exp] 57 / 6e-11 AT3G11210 402 / 2e-143 SGNH hydrolase-type esterase superfamily protein (.1) Lus10040197 [exp] 57 / 6e-11 AT3G11210 402 / 5e-143 SGNH hydrolase-type esterase superfamily protein (.1) Lus10035506 [exp] 54 / 8e-10 AT3G11210 244 / 7e-79 SGNH hydrolase-type esterase superfamily protein (.1) Lus10027675 [exp] 41 / 2e-05 AT5G62930 414 / 2e-148 SGNH hydrolase-type esterase superfamily protein (.1) Lus10000525 [exp] 37 / 0.0005 AT5G45920 337 / 4e-118 SGNH hydrolase-type esterase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G115900.1 pacid=42810594 polypeptide=Potri.016G115900.1.p locus=Potri.016G115900 ID=Potri.016G115900.1.v4.1 annot-version=v4.1 ATGGTAGGACTGCAGAGGCCACAGTTTGTGCTGTTCGGATCATCAATAGTTCAGCTCAGCTACATCAATGAAGGTTGGGGTGCTATTCTTGCTCACATCT ATGCTCGAAAGAAGTTTTGGGAATGCAATTTTCACAGGGCCATCTTGTGTTGTGACGATTCTCTCCAGAGAATGTCTCAACAAGGACAGCCAAGAGCTAA TCAATGCTGGAGGGCTCCTTTCTCCAGATCCTATCCAACTAGGAAACGAAGACATTTATTAGTCTAA
AA sequence Show only first row Show all	>Potri.016G115900.1 pacid=42810594 polypeptide=Potri.016G115900.1.p locus=Potri.016G115900 ID=Potri.016G115900.1.v4.1 annot-version=v4.1 MVGLQRPQFVLFGSSIVQLSYINEGWGAILAHIYARKKFWECNFHRAILCCDDSLQRMSQQGQPRANQCWRAPFSRSYPTRKRRHLLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G11210			SGNH hydrolase-type esterase s...		Potri.016G115900 [exp]	0	1
AT3G62410		CP12-2	CP12 DOMAIN-CONTAINING PROTEIN...		Potri.014G120700 [exp]	8.83	0.9452
AT3G15840		PIFI	post-illumination chlorophyll ...		Potri.001G204300 [exp]	14.49	0.9438
AT3G60590			unknown protein		Potri.014G061000 [exp]	15.42	0.9361
AT5G55210			unknown protein		Potri.001G356400 [exp]	16.43	0.9266
					Potri.015G023750 [exp]	21.16	0.9201
AT1G02560		NCLPP5, NCLPP1,...	NUCLEAR CLPP 5, NUCLEAR-ENCODE...		Potri.014G119700 [exp]	22.44	0.9402
AT5G23670		ATLCB2, LCB2	long chain base2 (.1.2)		Potri.015G103800 [exp]	23.23	0.9296	LJLCB2.1
AT3G20230			Ribosomal L18p/L5e family prot...		Potri.013G108700 [exp]	28.42	0.9382
AT5G07020			proline-rich family protein (....		Potri.001G032200 [exp]	28.80	0.9352
AT2G36430			Plant protein of unknown funct...		Potri.005G116100 [exp]	30.44	0.9038

Compare expression of checked genes

Potri.016G115900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.