Plant FIBer expression Database

Potri.016G116500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37640 40 / 0.0003 UBQ9 ubiquitin 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G100700
[exp]
171 / 2e-55 ND /
Potri.006G129600
[exp]
40 / 0.0004 AT5G20620 600 / 0.0 ubiquitin 4 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.016G116500.1 pacid=42810180 polypeptide=Potri.016G116500.1.p locus=Potri.016G116500 ID=Potri.016G116500.1.v4.1 annot-version=v4.1
ATGTATCCATTATACACTATAGGTGAGGTGAAGCTGGAGATTACCAATCGAACTAATGTGATTAGGAATCATCTAACTCTTAGGGGTAGCCATTACCTTG
AGAAGTTGGATGATTATCTCACACTCGAAGAATATGGATACAAAGGAGAGGCAACAATTCATATTGATGTTAGTCGCTCACTTGAAAACCTAGATGTTGA
CCTTGTGGTTGGGCTGCCAAATAATGGTTGGAAACTAGTAAGAGCACAAGAGACAACTATGGTGGCAGAATTGAAGGACAAAATCATGGAGCGTTGGGGC
ATTCCGACCGATAAAATGACATTGATTCGCCTCAACACAGTGATGGAAGATTCATATTACTTAATAGATTACCTTATTTCAAAACTTGGTGACGTTAAAG
TTGAAATCAACGATGAAAGTAAAGGGGTTGAAGAAAGCAACAATGGAAGTTATACCTAG
AA sequence
>Potri.016G116500.1 pacid=42810180 polypeptide=Potri.016G116500.1.p locus=Potri.016G116500 ID=Potri.016G116500.1.v4.1 annot-version=v4.1
MYPLYTIGEVKLEITNRTNVIRNHLTLRGSHYLEKLDDYLTLEEYGYKGEATIHIDVSRSLENLDVDLVVGLPNNGWKLVRAQETTMVAELKDKIMERWG
IPTDKMTLIRLNTVMEDSYYLIDYLISKLGDVKVEINDESKGVEESNNGSYT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G116500
[exp]
0 1
AT5G56510 APUM12 pumilio 12 (.1) Potri.001G298000
[exp]
19.44 1.0000
AT1G52900 Toll-Interleukin-Resistance (T... Potri.001G403800
[exp]
24.24 1.0000
AT1G55790 Domain of unknown function (DU... Potri.001G438200
[exp]
26.72 1.0000
Potri.001G276804
[exp]
30.19 1.0000
Potri.001G330250
[exp]
33.76 1.0000
AT1G21430 YUC11 Flavin-binding monooxygenase f... Potri.005G111800
[exp]
40.98 1.0000
AT5G44840 Pectin lyase-like superfamily ... Potri.006G252900
[exp]
45.36 1.0000
Potri.001G466250
[exp]
46.54 1.0000
Potri.013G052950
[exp]
56.12 1.0000
AT2G16430 ATPAP10, PAP10 purple acid phosphatase 10 (.1... Potri.004G160200
[exp]
59.44 1.0000

Potri.016G116500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.