Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05600 491 / 5e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 487 / 7e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G55970 475 / 1e-168 ATJRG21 jasmonate-regulated gene 21 (.1) AT2G38240 456 / 2e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G22880 257 / 3e-83 TT18, TDS4, ANS, LDOX TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2) AT1G17020 238 / 9e-76 ATSRG1, SRG1 senescence-related gene 1 (.1) AT3G21420 233 / 2e-73 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25300 228 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G24530 226 / 3e-71 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G54000 226 / 5e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G101100 [exp] 662 / 0 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 636 / 0 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G069300 [exp] 517 / 0 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G188000 [exp] 515 / 0 AT5G05600 511 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G382400 [exp] 253 / 2e-81 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.003G119100 [exp] 252 / 4e-81 AT4G22880 530 / 0.0 TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2) Potri.001G355100 [exp] 251 / 8e-81 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.010G023600 [exp] 250 / 2e-80 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G381700 [exp] 248 / 1e-79 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005037 [exp] 537 / 0 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004808 [exp] 527 / 0 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10004387 [exp] 463 / 5e-164 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10027807 [exp] 382 / 5e-133 AT5G05600 330 / 1e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10040112 [exp] 244 / 4e-78 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1) Lus10022292 [exp] 243 / 9e-78 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10006709 [exp] 243 / 2e-76 AT4G22880 573 / 0.0 TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2) Lus10006518 [exp] 240 / 2e-76 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011979 [exp] 238 / 8e-76 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1) Lus10028068 [exp] 237 / 9e-76 AT5G08640 429 / 1e-151 flavonol synthase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.016G117100.1 pacid=42810047 polypeptide=Potri.016G117100.1.p locus=Potri.016G117100 ID=Potri.016G117100.1.v4.1 annot-version=v4.1 ATGATGAACTGCTTGCAGAGTTGGCCAGAACCTGTGGTTCGAGTCCAATCTTTAGCCGCAAGTGGTATCCAGGCAATCCCAGAGCGTTATGTTAAGCCAC CTTCTCACAGACCGTTATCAAACAGTGATTTCTCACTACCTCAGGAGGTCAACATTCCTGTTATTGATTTCCAAAACGTTTTCTCTAACGACCAACGCCT CCGCGAAGAGGCCCTCCGTTGTATCTACAGAGCCTGTAGTGAATGGGGCTTCTTTCAAGTAGTGAACCATGGTGTGAGCCACGAACTGATGAAGGGGGTT CGTGAGATTTGGCGCGAGTTCTTTAACCTGCCAGTAGAAGTGAAGCAAGAGTATGCTAACAGTCCTGCTACGTATGAGGGGTATGGTAGCCGGTTGGGCG TGGAGAAAGGAGCAACTCTTGATTGGAGTGATTATTTCTTCCTTCATTACATGCCTGTTTCTCTCAGAAACCAAAACAAGTGGCCTGCAACCCCAGCTTC TTGCCGGGAATTGGTAGCTGAGTACGGCCGCGAGGTGGTTAAACTTGGTGGAAAGCTGATGAAGGCATTCTCTATGAACCTTGGCCTGGAAGAGGACTTC CTCCTTGATGCTTTTGGCGGAGAGGAAAATGTCGGTGCATGTTTAAGGGTTAATTACTATCCAAAGTGTCCACAGCCAGACCTCACACTAGGCCTCTCGC CGCACTCCGACCCTGGTGGAATGACCATTCTCCTGCCTGATGAAAACGTGGCTGGACTGCAAGTCCGTAGAAAGGACAGTTGGGTCACCGTTAAGCCAGC ACCAAACGCCTTTATTATAAACATAGGGGATCAAATCCAGGTACTGAGCAATGCCATCTACCAGAGCGTGGAGCACAGGGTGATTGTGAATTCTAATAAA GATAGAGTCTCTCTTGCCTTCTTCTATAACCCCAAGAGTGACTTGCTCATTGAACCATCCAAGGAACTCGTCACCGTCGACCGGCCGGCCCTCTACCCAC CGATGACATTCGATGAATACAGACTTTACATTAGGACAAAGGGTCCCTGCGGCAAGAAACAAGTTGAATCCCTAAAATCTCCTAGTCCATGTAATGAATG TTGA
AA sequence Show only first row Show all	>Potri.016G117100.1 pacid=42810047 polypeptide=Potri.016G117100.1.p locus=Potri.016G117100 ID=Potri.016G117100.1.v4.1 annot-version=v4.1 MMNCLQSWPEPVVRVQSLAASGIQAIPERYVKPPSHRPLSNSDFSLPQEVNIPVIDFQNVFSNDQRLREEALRCIYRACSEWGFFQVVNHGVSHELMKGV REIWREFFNLPVEVKQEYANSPATYEGYGSRLGVEKGATLDWSDYFFLHYMPVSLRNQNKWPATPASCRELVAEYGREVVKLGGKLMKAFSMNLGLEEDF LLDAFGGEENVGACLRVNYYPKCPQPDLTLGLSPHSDPGGMTILLPDENVAGLQVRRKDSWVTVKPAPNAFIINIGDQIQVLSNAIYQSVEHRVIVNSNK DRVSLAFFYNPKSDLLIEPSKELVTVDRPALYPPMTFDEYRLYIRTKGPCGKKQVESLKSPSPCNEC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G05600			2-oxoglutarate (2OG) and Fe(II...		Potri.016G117100 [exp]	0	1
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Potri.006G172801 [exp]	2.82	0.9565
AT4G20970	bHLH	bHLH162	basic helix-loop-helix (bHLH) ...		Potri.015G074500 [exp]	7.74	0.9590
AT3G48520		CYP94B3	cytochrome P450, family 94, su...		Potri.012G096800 [exp]	14.28	0.9558
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Potri.001G355200 [exp]	21.33	0.9274
AT2G26530		AR781	Protein of unknown function (D...		Potri.002G128500 [exp]	22.36	0.9414
AT5G05580		AtFAD8, SH1, FA...	fatty acid desaturase 8 (.1.2)		Potri.016G117500 [exp]	22.80	0.8824	Pt-FAD3.5
AT5G25880		ATNADP-ME3	Arabidopsis thaliana NADP-mali...		Potri.006G236500 [exp]	25.23	0.9392
AT1G61680		ATTPS14	terpene synthase 14 (.1.2)		Potri.004G030400 [exp]	26.98	0.9379
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Potri.007G118600 [exp]	28.61	0.9374
AT5G05600			2-oxoglutarate (2OG) and Fe(II...		Potri.006G101100 [exp]	32.32	0.9361

Compare expression of checked genes

Potri.016G117100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.