Potri.016G117700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05570 84 / 6e-20 transducin family protein / WD-40 repeat family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G101600 153 / 1e-49 AT5G05570 72 / 8e-16 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.016G117800 117 / 6e-32 AT5G05570 900 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.010G187700 87 / 3e-21 AT5G05570 1069 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.008G069700 74 / 1e-16 AT5G05570 624 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009082 92 / 6e-23 AT5G05570 358 / 6e-106 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10001254 81 / 2e-20 AT5G05570 85 / 9e-20 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10027810 80 / 4e-20 AT5G05570 84 / 2e-19 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10002478 76 / 4e-19 AT5G05570 73 / 3e-16 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10030399 69 / 8e-15 AT5G05570 977 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10037841 68 / 1e-14 AT5G05570 1009 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.016G117700.1 pacid=42809429 polypeptide=Potri.016G117700.1.p locus=Potri.016G117700 ID=Potri.016G117700.1.v4.1 annot-version=v4.1
ATGGCGACCAAATCATCCAATGAAGTTCAAAGCAAAAAGAGAGAGAAGAGAACTGGAAGGGAAAATTTATTGGGTTACAGCGAGGAAACAAAGCCCAGAA
GCAGGAAACTTGGAGAAATCGTAGCTAAGTACAGAAAATCCAAGGATGCCTTTTCCCTGGCTACGAGTGCAAAGAACAAGCTGGTGCAAAGGCAGGAAAA
GCTTGGTAAAATCAACAATCAAACTGAAGAGCTGGAAGGTAATTCAGAAGACTATGCATCATTGGCCAATGAACTTCTCAAGAAGATGGAGAAAAGAAAA
TGGTGGCAAATATGA
AA sequence
>Potri.016G117700.1 pacid=42809429 polypeptide=Potri.016G117700.1.p locus=Potri.016G117700 ID=Potri.016G117700.1.v4.1 annot-version=v4.1
MATKSSNEVQSKKREKRTGRENLLGYSEETKPRSRKLGEIVAKYRKSKDAFSLATSAKNKLVQRQEKLGKINNQTEELEGNSEDYASLANELLKKMEKRK
WWQI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G05570 transducin family protein / WD... Potri.016G117700 0 1
AT4G24970 Histidine kinase-, DNA gyrase ... Potri.015G100900 4.69 0.7804
AT3G03740 ATBPM4 BTB-POZ and MATH domain 4 (.1) Potri.009G156500 12.12 0.8015
AT1G63770 Peptidase M1 family protein (.... Potri.001G101975 14.86 0.7726
AT2G19170 SLP3 subtilisin-like serine proteas... Potri.001G151100 18.30 0.7852
Potri.019G023500 21.81 0.7491
AT3G19610 Plant protein of unknown funct... Potri.001G294600 25.09 0.7675
AT5G27240 DNAJ heat shock N-terminal dom... Potri.005G043200 30.00 0.7741
AT3G26040 HXXXD-type acyl-transferase fa... Potri.004G017900 37.22 0.7838
AT3G50930 BCS1 cytochrome BC1 synthesis (.1) Potri.002G032700 38.06 0.7825
AT4G33210 SLOMO SLOW MOTION, F-box family prot... Potri.006G220900 38.67 0.7672

Potri.016G117700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.