Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18610 37 / 0.0004 Protein kinase superfamily protein (.1.2) AT3G07070 37 / 0.0005 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G051600 [exp] 43 / 3e-06 AT3G07070 474 / 4e-165 Protein kinase superfamily protein (.1) Potri.002G241600 [exp] 36 / 0.001 AT3G07070 543 / 0.0 Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011866 [exp] 36 / 0.0007 AT3G07070 556 / 0.0 Protein kinase superfamily protein (.1) Lus10022799 [exp] 36 / 0.0007 AT3G07070 487 / 2e-171 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G118200.1 pacid=42810013 polypeptide=Potri.016G118200.1.p locus=Potri.016G118200 ID=Potri.016G118200.1.v4.1 annot-version=v4.1 ATGATGATGATTAGAACAGGAAAAATCATCCTGCATTTTGAGCACGAGCACGTGGTGGTTGTTGTTGTTGATGGCTATGAATTTGGACTCGCCAAGCTTG GTCCTTGTGGAGACAAGATGTATCCATCATCAAGAGTGATCTCTATCGGCGGAAAAAAATTGGCAAACTTAATGATGCACGCAACCTGTTTGATAAAATG CCTGGTGGAAATTTAG
AA sequence Show only first row Show all	>Potri.016G118200.1 pacid=42810013 polypeptide=Potri.016G118200.1.p locus=Potri.016G118200 ID=Potri.016G118200.1.v4.1 annot-version=v4.1 MMMIRTGKIILHFEHEHVVVVVVDGYEFGLAKLGPCGDKMYPSSRVISIGGKKLANLMMHATCLIKCLVEI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.016G118200 [exp]	0	1
AT4G36920	AP2_ERF	FL1, FLO2, AP2	FLORAL MUTANT 2, FLOWER 1, APE...		Potri.007G046200 [exp]	6.16	0.7956	AP2.15,RAP2
AT5G53420			CCT motif family protein (.1.2...		Potri.015G014000 [exp]	7.87	0.7826
AT4G22360			SWIB complex BAF60b domain-con...		Potri.016G013400 [exp]	16.12	0.7569
					Potri.004G183401 [exp]	22.13	0.7372
					Potri.019G036280 [exp]	23.06	0.7549
AT5G65180			ENTH/VHS family protein (.1.2)		Potri.005G080800 [exp]	23.23	0.7064
					Potri.003G162750 [exp]	27.16	0.7281
AT3G03440			ARM repeat superfamily protein...		Potri.017G128100 [exp]	27.65	0.7368
AT4G02810		FAF1	FANTASTIC FOUR 1, Protein of u...		Potri.002G053400 [exp]	32.24	0.7366
AT3G20640	bHLH	bHLH123	basic helix-loop-helix (bHLH) ...		Potri.001G410600 [exp]	32.64	0.7373

Compare expression of checked genes

Potri.016G118200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.