Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01340 88 / 5e-23 AtmSFC1 mitochondrial succinate-fumarate carrier 1, Mitochondrial substrate carrier family protein (.1) AT1G34065 44 / 6e-07 SAMC2 S-adenosylmethionine carrier 2 (.1) AT2G37890 42 / 4e-06 Mitochondrial substrate carrier family protein (.1) AT3G53940 41 / 6e-06 Mitochondrial substrate carrier family protein (.1) AT4G39460 40 / 2e-05 SAMC1, SAMT1 SAM TRANSPORTER1, S-adenosylmethionine carrier 1 (.1.2) AT5G17400 39 / 8e-05 ER-ANT1 endoplasmic reticulum-adenine nucleotide transporter 1 (.1) AT3G55640 37 / 0.0002 Mitochondrial substrate carrier family protein (.1) AT2G26360 37 / 0.0004 Mitochondrial substrate carrier family protein (.1) AT5G58970 36 / 0.0005 ATUCP2 uncoupling protein 2 (.1.2) AT5G66380 36 / 0.0006 ATFOLT1 folate transporter 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G119500 [exp] 104 / 3e-29 AT5G01340 542 / 0.0 mitochondrial succinate-fumarate carrier 1, Mitochondrial substrate carrier family protein (.1) Potri.003G053900 [exp] 42 / 3e-06 AT1G79900 419 / 2e-148 RABIDOPSIS MITOCHONDRIAL BASIC AMINO ACID CARRIER 2, Mitochondrial substrate carrier family protein (.1) Potri.001G247800 [exp] 42 / 4e-06 AT5G58970 456 / 3e-163 uncoupling protein 2 (.1.2) Potri.005G085900 [exp] 41 / 9e-06 AT4G39460 487 / 9e-175 SAM TRANSPORTER1, S-adenosylmethionine carrier 1 (.1.2) Potri.001G182000 [exp] 41 / 1e-05 AT1G79900 424 / 1e-150 RABIDOPSIS MITOCHONDRIAL BASIC AMINO ACID CARRIER 2, Mitochondrial substrate carrier family protein (.1) Potri.008G060900 [exp] 40 / 1e-05 AT3G55640 489 / 2e-175 Mitochondrial substrate carrier family protein (.1) Potri.006G091900 [exp] 40 / 1e-05 AT3G53940 483 / 4e-172 Mitochondrial substrate carrier family protein (.1) Potri.005G197200 [exp] 39 / 4e-05 AT4G39460 417 / 3e-147 SAM TRANSPORTER1, S-adenosylmethionine carrier 1 (.1.2) Potri.016G103300 [exp] 39 / 4e-05 AT3G53940 513 / 0.0 Mitochondrial substrate carrier family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027817 [exp] 96 / 7e-26 AT5G01340 526 / 0.0 mitochondrial succinate-fumarate carrier 1, Mitochondrial substrate carrier family protein (.1) Lus10005045 [exp] 96 / 1e-25 AT5G01340 518 / 0.0 mitochondrial succinate-fumarate carrier 1, Mitochondrial substrate carrier family protein (.1) Lus10024344 [exp] 42 / 6e-06 AT3G53940 417 / 4e-147 Mitochondrial substrate carrier family protein (.1) Lus10034658 [exp] 40 / 1e-05 AT5G17400 491 / 5e-177 endoplasmic reticulum-adenine nucleotide transporter 1 (.1) Lus10016445 [exp] 40 / 2e-05 AT5G58970 493 / 1e-177 uncoupling protein 2 (.1.2) Lus10004689 [exp] 40 / 3e-05 AT3G55640 482 / 1e-172 Mitochondrial substrate carrier family protein (.1) Lus10040709 [exp] 40 / 3e-05 AT5G58970 512 / 0.0 uncoupling protein 2 (.1.2) Lus10017874 [exp] 38 / 0.0001 AT5G17400 473 / 5e-170 endoplasmic reticulum-adenine nucleotide transporter 1 (.1) Lus10027755 [exp] 37 / 0.0002 AT3G54110 515 / 0.0 ARABIDOPSIS THALIANA UNCOUPLING PROTEIN 1, ARABIDOPSIS THALIANA PLANT UNCOUPLING MITOCHONDRIAL PROTEIN 1, plant uncoupling mitochondrial protein 1 (.1) Lus10022597 [exp] 37 / 0.0002 AT3G53940 486 / 3e-173 Mitochondrial substrate carrier family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00153 [poplar] [flax] Mito_carr Mitochondrial carrier protein
Representative CDS sequence Show only first row Show all	>Potri.016G119650.1 pacid=42809818 polypeptide=Potri.016G119650.1.p locus=Potri.016G119650 ID=Potri.016G119650.1.v4.1 annot-version=v4.1 ATGATTTCTGGTTTCCTTTCTGGAACTGCAGATCCAGTTTGCACAGGCCAATTTGATGTTGTCAGAACAAGGCTGATGGTTCAAAGCCGAGAAGGGGATG AATTGAAATGCAAAGGCTTAGTTCATGCTATCACAACAATCTATGCCGAGGAGGGGTGTCTTGCCTTGTGGAAAGGGATCACTGCCTAG
AA sequence Show only first row Show all	>Potri.016G119650.1 pacid=42809818 polypeptide=Potri.016G119650.1.p locus=Potri.016G119650 ID=Potri.016G119650.1.v4.1 annot-version=v4.1 MISGFLSGTADPVCTGQFDVVRTRLMVQSREGDELKCKGLVHAITTIYAEEGCLALWKGITA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G01340		AtmSFC1	mitochondrial succinate-fumara...		Potri.016G119650 [exp]	0	1
AT5G55810		ATNMNAT	nicotinate/nicotinamide mononu...		Potri.013G021900 [exp]	3.31	0.9331
					Potri.001G355650 [exp]	7.07	0.9210
AT1G58070			unknown protein		Potri.003G009400 [exp]	12.84	0.8995
AT2G03350			Protein of unknown function, D...		Potri.010G162400 [exp]	15.87	0.9069
AT1G62330			O-fucosyltransferase family pr...		Potri.011G010600 [exp]	16.12	0.8429
AT1G32310			unknown protein		Potri.001G138700 [exp]	16.58	0.8835
					Potri.019G001550 [exp]	16.73	0.9003
AT2G27140			HSP20-like chaperones superfam...		Potri.004G191000 [exp]	19.44	0.9093
					Potri.001G177201 [exp]	21.42	0.8939
AT5G02040		PRA1.A1	prenylated RAB acceptor 1.A1 (...		Potri.006G091300 [exp]	23.32	0.8796

Compare expression of checked genes

Potri.016G119650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.