Potri.016G120466 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47890 73 / 4e-15 AtRLP7 receptor like protein 7 (.1)
AT1G45616 63 / 1e-11 AtRLP6 receptor like protein 6 (.1)
AT3G11080 62 / 2e-11 AtRLP35 receptor like protein 35 (.1)
AT3G11010 62 / 3e-11 AtRLP34 receptor like protein 34 (.1)
AT5G27060 55 / 8e-09 AtRLP53 receptor like protein 53 (.1)
AT2G34930 53 / 2e-08 disease resistance family protein / LRR family protein (.1)
AT3G28890 53 / 3e-08 AtRLP43 receptor like protein 43 (.1.2)
AT3G05360 52 / 5e-08 AtRLP30 receptor like protein 30 (.1)
AT2G02220 52 / 6e-08 ATPSKR1 phytosulfokin receptor 1 (.1)
AT2G26730 51 / 1e-07 Leucine-rich repeat protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G120600 218 / 6e-66 AT1G47890 441 / 7e-137 receptor like protein 7 (.1)
Potri.001G128400 105 / 1e-26 AT1G45616 498 / 2e-159 receptor like protein 6 (.1)
Potri.001G437700 100 / 7e-25 AT1G47890 397 / 4e-122 receptor like protein 7 (.1)
Potri.001G389100 86 / 1e-19 AT5G27060 468 / 1e-149 receptor like protein 53 (.1)
Potri.016G126900 84 / 4e-19 AT1G45616 510 / 5e-165 receptor like protein 6 (.1)
Potri.011G104600 84 / 7e-19 AT2G15080 421 / 5e-129 receptor like protein 19 (.1.2)
Potri.016G127000 84 / 7e-19 AT1G47890 588 / 0.0 receptor like protein 7 (.1)
Potri.011G104900 80 / 2e-17 AT1G71400 362 / 2e-111 receptor like protein 12 (.1)
Potri.011G105150 78 / 8e-17 AT1G45616 405 / 3e-125 receptor like protein 6 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002215 143 / 2e-40 AT4G20140 202 / 7e-56 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1)
Lus10003387 143 / 1e-39 AT1G47890 394 / 3e-120 receptor like protein 7 (.1)
Lus10003389 143 / 2e-39 AT1G45616 432 / 7e-135 receptor like protein 6 (.1)
Lus10026415 138 / 8e-38 AT1G47890 424 / 3e-131 receptor like protein 7 (.1)
Lus10042239 127 / 5e-34 AT1G45616 395 / 1e-121 receptor like protein 6 (.1)
Lus10009330 121 / 4e-32 AT1G71400 245 / 2e-69 receptor like protein 12 (.1)
Lus10006824 117 / 1e-30 AT3G23110 185 / 2e-50 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1)
Lus10006825 116 / 3e-30 AT1G47890 377 / 6e-114 receptor like protein 7 (.1)
Lus10004310 103 / 1e-25 AT2G33060 358 / 6e-111 receptor like protein 27 (.1)
Lus10016401 94 / 2e-23 AT1G71390 87 / 6e-19 receptor like protein 11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Potri.016G120466.2 pacid=42810228 polypeptide=Potri.016G120466.2.p locus=Potri.016G120466 ID=Potri.016G120466.2.v4.1 annot-version=v4.1
ATGCCCTCCAGCATCAACACAGGTCTGGTTTCTGGCAGATGCCCGAGCGATCAGCAATCTTTGTTGCTCCAATTAAAGAAAACTCTTTTATTCAATGAAT
CTATGTCCACCAAACTGGTGACATGGAATCCCAGCTCGGATTGCTGCGAGTGGAGAGGTATAAGCTGCGATATTGGTGGGCTTAATCGTGTTATCGGCCT
CGACTTGAGCAATGAATCCATCACTGGTGGACTTGACGATTCAAGCGGGCTTTTCAGTCTTCAATTTCTTCAGAGTCTAAACTTGTCTTTCAACAGCTTC
AGCACAGCTCTGCCAGTCGGGTTTGCCAACCTCACGGATTTGATTTCACTGAATTTGTCCAGTGCTGGCTTTACAGGCCAGATTCCAAATGATATCTCAA
AGCTGACAAAGTTGGTCAGTCTTGATTTGTCTGCCCTTTCCTTCCCTGGAAGTCCTGCACTGAAACTCAAGAAGCCTAATTTTGCAACATTGGTTCAAAA
TCTCACACACCTAACAGAGCTCCTTCTTGATGGTGTTAATATATCAGCACACGGAAATGACTAG
AA sequence
>Potri.016G120466.2 pacid=42810228 polypeptide=Potri.016G120466.2.p locus=Potri.016G120466 ID=Potri.016G120466.2.v4.1 annot-version=v4.1
MPSSINTGLVSGRCPSDQQSLLLQLKKTLLFNESMSTKLVTWNPSSDCCEWRGISCDIGGLNRVIGLDLSNESITGGLDDSSGLFSLQFLQSLNLSFNSF
STALPVGFANLTDLISLNLSSAGFTGQIPNDISKLTKLVSLDLSALSFPGSPALKLKKPNFATLVQNLTHLTELLLDGVNISAHGND

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G47890 AtRLP7 receptor like protein 7 (.1) Potri.016G120466 0 1
AT5G27550 P-loop containing nucleoside t... Potri.005G031801 10.81 0.8786
Potri.017G047000 12.32 0.8639
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.003G017566 22.36 0.9068
AT5G40990 GLIP1 GDSL lipase 1 (.1) Potri.017G136601 23.23 0.8270
AT5G08450 unknown protein Potri.018G145552 29.94 0.8383
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Potri.007G140700 31.78 0.8731
AT4G19380 Long-chain fatty alcohol dehyd... Potri.004G234900 33.82 0.8482
AT1G53430 Leucine-rich repeat transmembr... Potri.001G386100 38.10 0.8588
AT3G01930 Major facilitator superfamily ... Potri.001G329100 38.49 0.8499
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.016G022250 47.01 0.8514

Potri.016G120466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.