Plant FIBer expression Database

Potri.016G121650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G102900
[exp]
117 / 2e-35 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.016G121650.1 pacid=42809754 polypeptide=Potri.016G121650.1.p locus=Potri.016G121650 ID=Potri.016G121650.1.v4.1 annot-version=v4.1
ATGGCTAATGCTGGTTCATTACCATCAGTTACATTGTCCCCTGATATTGTTCACACTCAGAAGGATGAGATTCCTGTCTCAAGTGACCGTAACTTTGCTA
TCCACGGTCAGATTACGATGCTAGTGCTGCTCTTGCTTTTCCCTTTATGTCTTCTGTTTATTCTCTACTGTATGTGTGCAAAACGACTAAGGGATGCCTC
AAAAGTCAGGCAACCGGAGCTTGTCTCGCCAAGGAATGTTTCCGGTAGTCCTGACTTCAAAGGTCAGATTAGAGATGGGTATTTGATGCATCAATCCGTG
GAGCACAAGACAACCCAGCAACCGGTATAG
AA sequence
>Potri.016G121650.1 pacid=42809754 polypeptide=Potri.016G121650.1.p locus=Potri.016G121650 ID=Potri.016G121650.1.v4.1 annot-version=v4.1
MANAGSLPSVTLSPDIVHTQKDEIPVSSDRNFAIHGQITMLVLLLLFPLCLLFILYCMCAKRLRDASKVRQPELVSPRNVSGSPDFKGQIRDGYLMHQSV
EHKTTQQPV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G121650
[exp]
0 1
AT5G03940 SRP54CP, CPSRP5... SIGNAL RECOGNITION PARTICLE 54... Potri.016G078600
[exp]
2.44 0.9605
AT2G32230 PRORP1 proteinaceous RNase P 1 (.1) Potri.006G160300
[exp]
4.00 0.9438
AT3G01480 ATCYP38, CYP38 ARABIDOPSIS CYCLOPHILIN 38, cy... Potri.001G351400
[exp]
5.19 0.9476
AT4G38620 MYB AtMYB4 myb domain protein 4 (.1) Potri.005G112000
[exp]
5.47 0.9178
AT4G01690 PPOX, HEMG1, PP... Flavin containing amine oxidor... Potri.002G186300
[exp]
7.48 0.9294
AT1G08810 MYB ATMYB60 myb domain protein 60 (.1.2) Potri.019G045900
[exp]
9.00 0.9083
AT1G54730 Major facilitator superfamily ... Potri.005G040000
[exp]
13.56 0.8953
AT1G68620 alpha/beta-Hydrolases superfam... Potri.018G028400
[exp]
14.42 0.8581
AT2G40490 HEME2 Uroporphyrinogen decarboxylase... Potri.019G048900
[exp]
17.88 0.9287
AT5G08280 HEMC hydroxymethylbilane synthase (... Potri.005G091600
[exp]
17.88 0.9128

Potri.016G121650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.