Potri.016G121900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01580 265 / 9e-90 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT1G07080 222 / 2e-72 Thioredoxin superfamily protein (.1)
AT4G12890 189 / 7e-60 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12900 174 / 4e-54 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12870 174 / 5e-54 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 166 / 4e-51 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G076200 226 / 2e-74 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.006G103000 217 / 2e-70 AT1G07080 196 / 3e-62 Thioredoxin superfamily protein (.1)
Potri.001G281004 213 / 3e-69 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
Potri.016G122200 204 / 1e-65 AT1G07080 204 / 3e-65 Thioredoxin superfamily protein (.1)
Potri.012G107300 203 / 4e-65 AT1G07080 205 / 1e-65 Thioredoxin superfamily protein (.1)
Potri.012G107600 202 / 7e-65 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.016G122000 197 / 3e-63 AT1G07080 185 / 3e-58 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002203 288 / 9e-99 AT5G01580 238 / 2e-79 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Lus10042270 233 / 7e-77 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10026384 231 / 3e-76 AT1G07080 281 / 1e-95 Thioredoxin superfamily protein (.1)
Lus10022669 189 / 7e-60 AT1G07080 170 / 2e-52 Thioredoxin superfamily protein (.1)
Lus10012503 187 / 2e-59 AT1G07080 171 / 1e-52 Thioredoxin superfamily protein (.1)
Lus10022670 175 / 4e-51 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10012502 158 / 2e-44 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Potri.016G121900.1 pacid=42810509 polypeptide=Potri.016G121900.1.p locus=Potri.016G121900 ID=Potri.016G121900.1.v4.1 annot-version=v4.1
ATGGCTTCTCATCCCTCTTTGTTCACCGCCTTCTTGCTTTTCATTTGCACTGCATTGTTCTTGATCGCATCTACTAGCAGCAGTCAAAACGTTACACTGT
CTTTGTACTATGAAACTCTGTGCCCATATTGTGCAGATTTCATAGTGAACCATTTGGTTAAAGTCTTTGACAAAGGACTCATCTCCATTGTCAATCTCAG
ATTGATCCCCTGGGGAAATGCTTTCATCCAACCTAATGGCAGCTTTGTTTGCCAGCATGGTACGAATGAATGTTTCCTAAATGCTATCGAAGCCTGCACT
GTAACCATTTACCCTGATGCGGTCAGGCATTTTAGATTTATACACTGTGTTGAGAAAATGTCCTTGGAAAACAAGATGAACGAGTGGGTTAATTGCTTTG
GTATGAGTGGGCTGGGCAAAGCACCAATTGATTGCTACACAAGTGGATATGGGGAAGTGCTTCAGAGAAAATATGCAGCTGAAACTTCCCAGCTCAATCC
ACCCCATAGATTTGTGCCATGGGTGGTTGTGAATAATCAACCACTCCGAGAGGACTTTGAGAATTTTGTGAGCTATGTCTGCAAGGCTTATAGAGGGACG
AAAATCCCAGAGGCCTGCAAATCACTTCCTCTGGAGAGCAATTCATCGCAGAAGGAAAATCACATTAATTCAGTTTGCTATGTAGACCAAACCAGCAACC
TGACATCATCAGCACCGGCAATAAATTGA
AA sequence
>Potri.016G121900.1 pacid=42810509 polypeptide=Potri.016G121900.1.p locus=Potri.016G121900 ID=Potri.016G121900.1.v4.1 annot-version=v4.1
MASHPSLFTAFLLFICTALFLIASTSSSQNVTLSLYYETLCPYCADFIVNHLVKVFDKGLISIVNLRLIPWGNAFIQPNGSFVCQHGTNECFLNAIEACT
VTIYPDAVRHFRFIHCVEKMSLENKMNEWVNCFGMSGLGKAPIDCYTSGYGEVLQRKYAAETSQLNPPHRFVPWVVVNNQPLREDFENFVSYVCKAYRGT
KIPEACKSLPLESNSSQKENHINSVCYVDQTSNLTSSAPAIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G01580 OSH1 OAS HIGH ACCUMULATION 1, gamma... Potri.016G121900 0 1
AT4G21450 PapD-like superfamily protein ... Potri.013G147800 1.00 0.9341
AT4G36930 bHLH SPT, bHLH024 SPATULA, basic helix-loop-heli... Potri.005G139700 3.74 0.9176
AT4G39730 Lipase/lipooxygenase, PLAT/LH2... Potri.003G107100 6.00 0.9247
AT1G79500 ATKDSA1, KDSA Aldolase-type TIM barrel famil... Potri.002G061900 6.00 0.9295 KDSA.1
AT5G19530 ACL5 ACAULIS 5, S-adenosyl-L-methio... Potri.008G151800 6.32 0.9242
AT2G36570 Leucine-rich repeat protein ki... Potri.006G117200 6.92 0.9307
AT3G60550 CYCP3;2 cyclin p3;2 (.1) Potri.014G066400 7.34 0.9183
AT3G47830 DNA glycosylase superfamily pr... Potri.015G071300 7.74 0.9171
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Potri.015G104700 10.81 0.9123
AT3G55770 LIM WLIM2b WLIM2b, GATA type zinc finger ... Potri.008G063600 10.95 0.8897

Potri.016G121900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.