Potri.016G122000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07080 185 / 2e-58 Thioredoxin superfamily protein (.1)
AT5G01580 175 / 9e-55 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12900 147 / 6e-44 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12890 143 / 2e-42 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 142 / 7e-42 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
AT4G12870 137 / 7e-40 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G103000 344 / 5e-121 AT1G07080 196 / 3e-62 Thioredoxin superfamily protein (.1)
Potri.016G121900 197 / 3e-63 AT5G01580 263 / 3e-89 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Potri.016G122200 194 / 1e-61 AT1G07080 204 / 3e-65 Thioredoxin superfamily protein (.1)
Potri.012G107600 189 / 8e-60 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.012G107300 189 / 1e-59 AT1G07080 205 / 1e-65 Thioredoxin superfamily protein (.1)
Potri.009G076200 174 / 4e-54 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.001G281004 166 / 5e-51 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022670 231 / 2e-72 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10012502 212 / 4e-65 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10002203 181 / 7e-57 AT5G01580 238 / 2e-79 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Lus10042270 176 / 7e-55 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10026384 175 / 2e-54 AT1G07080 281 / 1e-95 Thioredoxin superfamily protein (.1)
Lus10022669 154 / 9e-47 AT1G07080 170 / 2e-52 Thioredoxin superfamily protein (.1)
Lus10012503 151 / 2e-45 AT1G07080 171 / 1e-52 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Potri.016G122000.1 pacid=42809198 polypeptide=Potri.016G122000.1.p locus=Potri.016G122000 ID=Potri.016G122000.1.v4.1 annot-version=v4.1
ATGGCTTCTACAAAACTAGTCTTCTCATTCATCGTTGCTTCCTTCTTGGTCTTCCTTCTACCTCCATCTCATGCTGCTTCTCACTCAGATTTCGAAGATA
TCAAGATATCATCCTCTATCGATTCTCAAATGGTTAACCTCTCTGTTTACTATGAAGCATTAAGCCCATCTTGTGCAACCTTCATTATCCAAAATCTCAC
AGGTGTCTTCGACGATGATCTCATCACCATCACCAATCTCAGGATGGTACCTTGGGGTAATGCTCATGTCAACGAAACAGACAACACCATCATTTGTCAG
AATGGTCGTGATGAATGTTTTCTGCATAAAATTCAAGCCTGCGCCATCAATGTCTGGAATGATGTGGACAAATATTATGCACTGATTCACTGCATGGAGT
TCCTTGTTATCGATGGAACGCATTCGGATTGGCAGTCTTGTTTCAACTCGCTTGGATTGTCTGAAGAACCTATTTTGGAGTGTTATAACAATGGAACTGG
AGCAAAGCTTCAAGCTTTATATGGTTACGAAACTGCACATCTTGATCCGCCTCATGTGTTTATGCCTTGGGTAGTCGTGAATAATAAATCACTCGGAAAG
GACTACGGAGATTTCACCACCTATATCTGCAGTGCATACGAAGGCAAAGTCAAGCCCAATGCCTGCAAATCATCCACCTAA
AA sequence
>Potri.016G122000.1 pacid=42809198 polypeptide=Potri.016G122000.1.p locus=Potri.016G122000 ID=Potri.016G122000.1.v4.1 annot-version=v4.1
MASTKLVFSFIVASFLVFLLPPSHAASHSDFEDIKISSSIDSQMVNLSVYYEALSPSCATFIIQNLTGVFDDDLITITNLRMVPWGNAHVNETDNTIICQ
NGRDECFLHKIQACAINVWNDVDKYYALIHCMEFLVIDGTHSDWQSCFNSLGLSEEPILECYNNGTGAKLQALYGYETAHLDPPHVFMPWVVVNNKSLGK
DYGDFTTYICSAYEGKVKPNACKSST

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G07080 Thioredoxin superfamily protei... Potri.016G122000 0 1
AT4G23430 AtTic32-IVa translocon at the inner envelo... Potri.012G143600 3.60 0.9966
AT5G45910 GDSL-like Lipase/Acylhydrolase... Potri.004G054400 4.89 0.9966
AT5G18020 SAUR-like auxin-responsive pro... Potri.004G164700 6.00 0.9959
AT5G04660 CYP77A4 "cytochrome P450, family 77, s... Potri.008G025500 7.21 0.9958
AT1G11600 CYP77B1 "cytochrome P450, family 77, s... Potri.004G019000 9.48 0.9954
AT5G33370 GDSL-like Lipase/Acylhydrolase... Potri.019G024800 9.48 0.9956
AT5G02890 HXXXD-type acyl-transferase fa... Potri.003G082100 11.61 0.9948
AT5G17050 UGT78D2 UDP-glucosyl transferase 78D2 ... Potri.009G133300 12.24 0.9549 Pt-UF3.2
AT1G19190 alpha/beta-Hydrolases superfam... Potri.009G104600 12.64 0.9935
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Potri.004G121000 15.00 0.9716

Potri.016G122000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.