Potri.016G122200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07080 205 / 2e-65 Thioredoxin superfamily protein (.1)
AT5G01580 184 / 9e-58 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12890 179 / 1e-55 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12900 172 / 6e-53 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 166 / 2e-50 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
AT4G12870 159 / 8e-48 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G107600 484 / 1e-175 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.012G107300 484 / 2e-175 AT1G07080 205 / 1e-65 Thioredoxin superfamily protein (.1)
Potri.016G121900 204 / 2e-65 AT5G01580 263 / 3e-89 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Potri.009G076200 203 / 1e-64 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.006G103000 190 / 9e-60 AT1G07080 196 / 3e-62 Thioredoxin superfamily protein (.1)
Potri.001G281004 187 / 1e-58 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
Potri.016G122000 184 / 1e-57 AT1G07080 185 / 3e-58 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042270 210 / 3e-67 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10026384 207 / 2e-66 AT1G07080 281 / 1e-95 Thioredoxin superfamily protein (.1)
Lus10022669 201 / 4e-64 AT1G07080 170 / 2e-52 Thioredoxin superfamily protein (.1)
Lus10012503 189 / 1e-59 AT1G07080 171 / 1e-52 Thioredoxin superfamily protein (.1)
Lus10002203 188 / 3e-59 AT5G01580 238 / 2e-79 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Lus10022670 153 / 1e-42 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10012502 140 / 1e-37 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Potri.016G122200.1 pacid=42810305 polypeptide=Potri.016G122200.1.p locus=Potri.016G122200 ID=Potri.016G122200.1.v4.1 annot-version=v4.1
ATGGGCTCTTCTCCATTACTCTCTTTCCTTGTTCTCACTTCTCTGGTGGTGTTGTTCGTCACCCCTTCCCATTCTTCAGAGTACGATGTTGTTCAGGAAC
CAGCGCCTCCTGTTACGTCCAGGAAAATCTCTCGCAATTCTGAGAAAGTTACAATGTCTTTATATTATGAATCTCTTTGTCCATATTGCAGCAGTTTCAT
TGCAGGTCCCCTAGCTCAGGTCCTGGAGACTGATCTCATGACCATTCTCAATCTCAGACTGGTTCCATGGGGAAATGCTATTCTCGACTCCAACAATACC
ATTGAGTGTCAGCATGGGGAAGATGAATGCTATCTGAACATCATACAAGCTTGTGCCATCAACCTCTGGCCTGATTTGAAGAAGCACTTTGATTTCATCA
AGTGTATCGAAAAGCAATATAAAGCTCCTGATAGATATGGAGCAGAAGAATCCTGGGAAGTATGTTCTGGTATATTGAGACTGTCTACACAATCCATCAA
GAAATGCTATGACAGTGGACATGGAAAAGAGCTTGTCCTACAAAATGGCAAAGAAACAGATCATCTCAGACCACCTCACAAATACGTGCCATGGGTGGTA
GTAGATGATACACCTCTCCTTGATGACTATGGGAGTTTCATTCACTATGTTTGCAAGGCATACAAAGGCAAGTCTTTGCCCAAGACTTGCAGTTCACATC
CCAACACCTCAATTAACAAGGACACCTCACTCCAATCAGTCTGTCATGCAAGCGAAGCGAGGTCAGGTGACAGTTCAGGGAAGCACCAGATGAAGATGGA
ACCCCTTGCATGA
AA sequence
>Potri.016G122200.1 pacid=42810305 polypeptide=Potri.016G122200.1.p locus=Potri.016G122200 ID=Potri.016G122200.1.v4.1 annot-version=v4.1
MGSSPLLSFLVLTSLVVLFVTPSHSSEYDVVQEPAPPVTSRKISRNSEKVTMSLYYESLCPYCSSFIAGPLAQVLETDLMTILNLRLVPWGNAILDSNNT
IECQHGEDECYLNIIQACAINLWPDLKKHFDFIKCIEKQYKAPDRYGAEESWEVCSGILRLSTQSIKKCYDSGHGKELVLQNGKETDHLRPPHKYVPWVV
VDDTPLLDDYGSFIHYVCKAYKGKSLPKTCSSHPNTSINKDTSLQSVCHASEARSGDSSGKHQMKMEPLA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G07080 Thioredoxin superfamily protei... Potri.016G122200 0 1
AT3G44880 PAO, LLS1, ACD1 LETHAL LEAF-SPOT 1 HOMOLOG, AC... Potri.009G004100 15.36 0.7280
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Potri.017G106500 18.70 0.7255
AT1G27650 C3HZnF ATU2AF35A U2 snRNP auxiliary factor smal... Potri.009G149600 19.89 0.7233
AT5G42340 PUB15 Plant U-Box 15 (.1) Potri.003G214100 29.58 0.7230
AT5G45290 RING/U-box superfamily protein... Potri.006G190500 32.07 0.6729
AT1G59610 DRP2B, CF1, ADL... Dynamin related protein 2B, dy... Potri.013G096701 32.78 0.6679
AT5G54310 NEV, AGD5 NEVERSHED, ARF-GAP domain 5 (.... Potri.001G406300 37.78 0.6854
AT3G10550 MTM1, AtMTM1 Arabidopsis thaliana myotubula... Potri.008G026900 37.94 0.7148
AT3G22470 Pentatricopeptide repeat (PPR)... Potri.019G062332 42.73 0.7024
AT1G05170 Galactosyltransferase family p... Potri.004G013900 44.49 0.6702

Potri.016G122200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.